VLRKLKSGLERGLDTFDSTIEIIMQNLKTELESQETENFLEQLISRIFQVVSRLTGVRIRNVQVPDITMEATSENSANVL
IPITADVTVSLPFLGEIVDLDLNVDLQTTVSIETDTEDPQVVVGECTNNPESISLTVLHSRFGLVNDVVDIGVNLARRVV
SSVVEGELCPRFRELLESLDAECVEKLIGESQ
The query sequence (length=192) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5wd6:A | 195 | 195 | 1.0000 | 0.9846 | 0.9846 | 1.42e-132 | 6o1t:A, 6o1t:B |
2 | 4keg:A | 535 | 113 | 0.1510 | 0.0542 | 0.2566 | 0.096 | 4n4x:A |
3 | 8axc:B | 532 | 40 | 0.0781 | 0.0282 | 0.3750 | 0.54 | 8axc:A, 8axc:C, 8axc:D |
4 | 6wvj:C | 1117 | 63 | 0.0990 | 0.0170 | 0.3016 | 0.61 | |
5 | 6kcl:B | 545 | 169 | 0.2292 | 0.0807 | 0.2604 | 0.69 | 6jwu:B, 6jwv:B, 6jwx:B, 6jwy:B |
6 | 7d6l:A | 142 | 46 | 0.0781 | 0.1056 | 0.3261 | 1.3 | |
7 | 7o3e:L | 445 | 53 | 0.0781 | 0.0337 | 0.2830 | 3.1 | |
8 | 3cmc:O | 334 | 89 | 0.1250 | 0.0719 | 0.2697 | 9.7 | 3cmc:P, 3cmc:Q, 3cmc:R, 1dbv:O, 1dbv:P, 1dbv:Q, 1dbv:R, 2dbv:O, 2dbv:P, 2dbv:Q, 2dbv:R, 3dbv:O, 3dbv:P, 3dbv:Q, 3dbv:R, 4dbv:O, 4dbv:P, 4dbv:Q, 4dbv:R, 1gd1:O, 1gd1:P, 1gd1:Q, 1gd1:R, 1npt:O, 1npt:P, 1npt:Q, 1npt:R, 1nq5:O, 1nq5:Q, 1nq5:A, 1nq5:C, 1nqa:O, 1nqa:P, 1nqa:Q, 1nqa:R, 1nqo:O, 1nqo:Q, 1nqo:A, 1nqo:C |
9 | 7fgq:A | 190 | 28 | 0.0677 | 0.0684 | 0.4643 | 10.0 |