VLPLDPAVPAPLCPHGPTLLFVKVTQGAAATRRFYACSACRDRKDCNFFQWEDEKLSGARLAAREAHNRRCQPPLSRTQC
VERYLKFIELPLTQRKFCQTCQQLLLPDDWGQHSEHQVLGNVSITQLRRPSQLLYPLENAATNAQYLFADRSCQFLVDLL
SALGFRRVLCVGTPRLHELIKLTASGDKKSNIKSLLLDIDFRYSQFYMEDSFCHYNMFNHHFFDGKTALEVCRAFLQEDK
GEGIIMVTDPPFGGLVEPLAITFKKLIAMWKEGQSQDDSHKELPIFWIFPYFFESRICQFFPSFQMLDYQVDYDNHALYK
HGKTGRKQSPVRIFTNIPPNKIILPTEEGYRFCSPCQRYVSLENQHCELCNSCTSKDGRKWNHCFLCKKCVKPSWIHCSI
CNHCAVPDHSCEG
The query sequence (length=413) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6uca:D | 416 | 413 | 1.0000 | 0.9928 | 1.0000 | 0.0 | 6uca:A, 6uca:B, 6uca:C, 6uca:E, 6uca:F |
2 | 7jl5:B | 90 | 45 | 0.0387 | 0.1778 | 0.3556 | 2.0 | 7jl5:A |
3 | 4z2c:C | 198 | 104 | 0.0533 | 0.1111 | 0.2115 | 4.7 | 4z2c:D, 4z2d:D, 4z2d:C, 4z2e:D, 4z2e:C |
4 | 8epx:D | 506 | 16 | 0.0242 | 0.0198 | 0.6250 | 4.9 | 8epx:C, 8epx:A, 8epx:B |
5 | 8hf3:A | 295 | 33 | 0.0339 | 0.0475 | 0.4242 | 8.0 | |
6 | 5swi:B | 693 | 94 | 0.0557 | 0.0332 | 0.2447 | 8.2 | 5swi:A, 5swi:C, 5swi:D |
7 | 7uhy:C | 578 | 51 | 0.0387 | 0.0277 | 0.3137 | 9.4 |