VLPLDPAVPAPLCPHGPTLLFVKTRRFYACSACRDRKDCNFFQWEDEKLSGARLAAREAHNRRCQPPLSRTQCVERYLKF
IELPLTQRKFCQTCQQLLLPDDWGQHSEHQVLGNVSITQLRRPSQLLYPLENAATNAQYLFADRSCQFLVDLLSALGFRR
VLCVGTPRLHELIKLTASGDKKSNIKSLLLDIDFRYSQFYMEDSFCHYNMFNHHFFDGKTALEVCRAFLQEDKGEGIIMV
TDPPFGGLVEPLAITFKKLIAMWKEGQSQDDSHKELPIFWIFPYFFESRICQFFPSFQMLDYQVDYDNHALYKHGRKQSP
VRIFTNIPPNKIILPTEEGYRFCSPCQRYVSLENQHCELCNSCTSKDGRKWNHCFLCKKCVKPSWIHCSICNHCAVPDHS
CE
The query sequence (length=402) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6uca:D | 416 | 412 | 1.0000 | 0.9663 | 0.9757 | 0.0 | 6uca:A, 6uca:B, 6uca:C, 6uca:E, 6uca:F |
2 | 4z2c:C | 198 | 104 | 0.0547 | 0.1111 | 0.2115 | 4.1 | 4z2c:D, 4z2d:D, 4z2d:C, 4z2e:D, 4z2e:C |
3 | 8epx:D | 506 | 16 | 0.0249 | 0.0198 | 0.6250 | 4.9 | 8epx:C, 8epx:A, 8epx:B |
4 | 8hf3:A | 295 | 33 | 0.0348 | 0.0475 | 0.4242 | 8.8 | |
5 | 7jl5:B | 90 | 42 | 0.0398 | 0.1778 | 0.3810 | 8.8 | 7jl5:A |
6 | 7uhy:C | 578 | 51 | 0.0398 | 0.0277 | 0.3137 | 9.3 |