BioLiP

>protein
VLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYL
EGKIDYGEYMDKNNVRRQATTIIADNIIFLS

The query sequence (length=111) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6rup:A	111	111	1.0000	1.0000	1.0000	5.95e-80	6rup:B, 8uzt:A, 8uzt:C, 8uzt:D
2	8uzt:B	100	110	0.8919	0.9900	0.9000	2.36e-65
3	3ulp:C	116	114	0.3874	0.3707	0.3772	2.50e-22	3ulp:A, 3ulp:B, 3ulp:D
4	1eqq:B	120	103	0.3243	0.3000	0.3495	1.36e-18	1eqq:A, 1eyg:A, 1eyg:B, 1eyg:C, 1eyg:D
5	5odn:D	106	110	0.3333	0.3491	0.3364	3.48e-16	5odn:F, 5odn:G, 5odn:B, 5odn:C, 5odn:A, 5odn:E, 5odn:H
6	6irq:C	104	102	0.3423	0.3654	0.3725	2.02e-15	6irq:A, 6irq:B, 6irq:D, 6jdg:C, 6jdg:A, 6jdg:B, 6jdg:D, 7vum:A, 7vum:C, 5yun:B, 5yun:A, 5yun:D
7	5odp:G	100	107	0.3153	0.3500	0.3271	9.12e-14	5odp:A
8	2vw9:A	108	105	0.2432	0.2500	0.2571	9.62e-10	2vw9:B
9	6bhx:C	102	105	0.3063	0.3333	0.3238	1.09e-08	6bhx:A, 6bhx:B
10	7dep:B	102	105	0.2883	0.3137	0.3048	1.82e-07
11	8gw5:A	99	105	0.2703	0.3030	0.2857	3.25e-06	7ym1:A
12	3vdy:A	101	105	0.2523	0.2772	0.2667	6.17e-06	3vdy:B
13	3udg:C	214	103	0.2162	0.1121	0.2330	0.065	3udg:B, 3udg:A
14	3udg:C	214	82	0.1982	0.1028	0.2683	0.42	3udg:B, 3udg:A
15	4oau:C	692	46	0.1441	0.0231	0.3478	1.2	4g8l:A, 4g8l:B, 4g8l:C, 4g8l:D, 4oav:B, 4oav:D, 1wdy:A
16	2wjd:A	244	80	0.1802	0.0820	0.2500	3.5	3qy8:A, 2wje:A, 2wjf:A
17	4fo8:C	266	32	0.0901	0.0376	0.3125	4.2	4fo7:A, 4fo7:B, 4fo7:C, 4fo7:D, 4fo8:A, 4fo8:B, 4fo8:D, 4juq:A, 4juq:B, 4juq:C, 4juq:D
18	4jqp:A	330	20	0.0901	0.0303	0.5000	5.4	4jqp:B
19	6quz:D	574	52	0.1171	0.0226	0.2500	8.4	6quz:B, 6qv0:B, 6qv0:D, 6qv1:B, 6qv1:D, 6qv2:B, 6qv2:D

[Back]