BioLiP

>protein
VLDRYIGKTIFTTIMMTLFMLVSLSGIIKFVDQLKKAGQGSYDALGAGMYTLLSVPKDVQIFFPMAALLGALLGLGMLAQ
RSELVVMQASGFTRMQVALSVMKTAIPLVLLTMAIGEWVAPQGEQMARNYRAQAMYGGSLLSTQQGLWAKDGNNFVYIER
VKGDEELGGISIYAFNENRRLQSVRYAATAKFDPEHKVWRLSQVDESDLTNPKQITGSQTVNLTPDKLGVVALDPDALSI
SGLHNYVKYAGRYQLNMWSKIFQPLSVAVMMLMALSFIFGPLRSVPMGVRVVTGISFGFVFYVLDQIFGPLTLVYGIPPI
IGALLPSASFFLISLWLLMRK

The query sequence (length=341) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6mhu:G	341	341	1.0000	1.0000	1.0000	0.0
2	6s8g:G	244	135	0.3959	0.5533	1.0000	4.48e-88	7efo:G, 6mi7:G, 6s8h:G, 6s8n:G
3	6s8g:G	244	104	0.2991	0.4180	0.9808	4.27e-64	7efo:G, 6mi7:G, 6s8h:G, 6s8n:G
4	8frl:G	338	348	0.3138	0.3166	0.3075	8.91e-49	8frm:G, 8fro:G, 8ufg:G, 8ufh:G
5	8frn:G	297	347	0.2933	0.3367	0.2882	7.43e-39
6	8frn:F	289	143	0.0909	0.1073	0.2168	0.005
7	8frl:F	316	143	0.0909	0.0981	0.2168	0.005	8frm:F, 8fro:F, 8ufg:F, 8ufh:F
8	6mhu:F	311	139	0.1085	0.1190	0.2662	0.071
9	2yep:A	173	70	0.0616	0.1214	0.3000	0.32	2yep:C
10	8frp:F	223	126	0.0762	0.1166	0.2063	1.5
11	2gm8:A	217	75	0.0587	0.0922	0.2667	5.9	2gm8:B, 2gm8:C, 2gm8:D
12	7efo:F	219	86	0.0762	0.1187	0.3023	7.3
13	3aoe:F	417	68	0.0733	0.0600	0.3676	9.6	3aoe:E, 3aoe:C, 3aoe:D

[Back]