VLAHRLAEIRKALGHARQADVAALMGVSQARVSKLESGDLSHTELGTLQAYVAALGGHLRIVAEFGENTVELTALEHH
The query sequence (length=78) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6lty:A | 78 | 78 | 1.0000 | 1.0000 | 1.0000 | 5.07e-50 | 6lty:B |
2 | 4y0e:H | 308 | 67 | 0.2692 | 0.0682 | 0.3134 | 0.098 | 4y0e:A, 4y0e:B, 4y0e:C, 4y0e:D, 4y0e:E, 4y0e:F, 4y0e:G |
3 | 8tac:B | 66 | 37 | 0.1795 | 0.2121 | 0.3784 | 3.5 | |
4 | 8jfu:B | 171 | 28 | 0.1795 | 0.0819 | 0.5000 | 4.4 | 8jfr:B, 8jfr:D, 8jfr:A, 8jfr:C, 8jft:C, 8jfu:D, 8jfu:A, 8jg9:C, 8jg9:F |
5 | 8jfu:C | 140 | 28 | 0.1795 | 0.1000 | 0.5000 | 5.5 | |
6 | 5e6t:B | 284 | 37 | 0.1923 | 0.0528 | 0.4054 | 6.6 | |
7 | 6gzd:A | 297 | 30 | 0.1410 | 0.0370 | 0.3667 | 7.2 | 5fqd:C, 5fqd:F, 8g66:C |
8 | 8rcw:A | 205 | 49 | 0.2308 | 0.0878 | 0.3673 | 7.4 | 8rcw:B |
9 | 6vs4:A | 223 | 18 | 0.1282 | 0.0448 | 0.5556 | 8.7 | 6vs4:B |