BioLiP

>protein
VKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDVRELSKTYIIGELHPDD
RSKIA

The query sequence (length=85) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1aw3:A	94	85	0.9882	0.8936	0.9882	3.49e-58	1axx:A, 2axx:A, 1b5a:A, 1b5b:A, 1bfx:A, 1blv:A, 1do9:A, 1mny:A
2	1hko:A	104	85	0.9176	0.7500	0.9176	5.12e-55	1aqa:A, 1cyo:A, 1ehb:A, 1es1:A, 1f03:A, 1f04:A, 1i5u:A, 1ib7:A, 1j0q:A, 1jex:A, 1lqx:A, 1lr6:A, 1m20:A, 1m2i:A, 1m2m:A, 1m59:A, 1nx7:A, 1sh4:A, 1u9m:A, 1u9m:B, 1u9m:C, 1u9m:D, 1u9m:E, 1u9m:F, 1u9u:A, 3x32:A, 3x33:A, 3x34:A, 3x35:A
3	2i96:A	108	84	0.8941	0.7037	0.9048	8.17e-54	4hin:A, 4hin:B, 4hin:C, 4hin:D, 2m33:A
4	3ozz:B	82	81	0.7529	0.7805	0.7901	9.02e-46
5	2i89:A	90	80	0.6706	0.6333	0.7125	2.54e-40	2i89:B, 2i89:C, 2i89:D, 1icc:A, 1icc:B, 1icc:D, 1lj0:A, 1lj0:B, 1lj0:C, 1lj0:D, 3mus:B
6	1awp:A	86	80	0.5647	0.5581	0.6000	4.16e-34	1awp:B, 1b5m:A, 1eue:A, 1eue:B, 4hil:A, 4hil:B, 1icc:C, 3mus:A
7	3ner:B	91	80	0.5765	0.5385	0.6125	2.49e-33	3ner:A
8	2ibj:A	86	83	0.5765	0.5698	0.5904	5.66e-32
9	4b8n:B	90	74	0.3765	0.3556	0.4324	1.52e-13	4b8n:A, 4b8n:C, 4b8n:D
10	8tgb:A	108	76	0.2824	0.2222	0.3158	1.14e-11	8tgb:B
11	3lf5:A	87	72	0.2824	0.2759	0.3333	1.44e-11	3lf5:B
12	1kbi:A	504	57	0.2941	0.0496	0.4386	1.79e-11	1fcb:A, 1fcb:B, 1kbi:B, 1kbj:A, 1kbj:B, 3ks0:A, 3ks0:B, 1lco:A, 1lco:B, 1ldc:A, 1ltd:A, 1ltd:B, 2oz0:A, 2oz0:B, 1qcw:A, 1qcw:B, 1sze:A, 1sze:B, 1szf:A, 1szf:B, 1szg:A, 1szg:B
13	1cxy:A	81	80	0.3059	0.3210	0.3250	2.08e-11
14	7bwh:A	88	84	0.3294	0.3182	0.3333	1.55e-10
15	1x3x:A	82	51	0.2824	0.2927	0.4706	1.77e-09	1x3x:B
16	1sox:A	463	81	0.3765	0.0691	0.3951	1.06e-08	2a9a:A, 2a9a:B, 2a9b:A, 2a9c:A, 2a9c:B, 2a9d:A, 2a9d:B, 3hbp:A, 3hbq:A, 1sox:B
17	1mj4:A	79	73	0.3176	0.3418	0.3699	1.25e-07
18	6nzx:A	76	78	0.2706	0.3026	0.2949	0.15
19	1k6m:A	432	48	0.1412	0.0278	0.2500	2.6	1c7z:A, 1c7z:B, 1c80:A, 1c80:B, 1c81:A, 1fbt:A, 1fbt:B, 1k6m:B, 1tip:A, 1tip:B
20	1kwm:A	402	50	0.2118	0.0448	0.3600	3.4	1kwm:B, 1zli:A
21	8dyu:A	2562	29	0.1294	0.0043	0.3793	4.0	8dyv:A
22	2dkc:A	536	43	0.1294	0.0205	0.2558	4.2	2dkc:B, 2dkd:A, 2dkd:B
23	8fcy:A	2864	29	0.1294	0.0038	0.3793	4.2	8fd6:A, 8fdt:A
24	8pqw:A	2892	29	0.1294	0.0038	0.3793	4.5	8pqy:A, 8pqz:A, 8pqz:J
25	5nug:A	2920	29	0.1294	0.0038	0.3793	4.5	5nug:B
26	2d2c:D	168	24	0.1294	0.0655	0.4583	4.9	2d2c:Q, 2e74:D, 2e75:D, 2e76:D, 4h0l:D, 4h13:D, 4i7z:D, 4pv1:D, 1vf5:D, 1vf5:Q
27	7z8g:A	3047	29	0.1294	0.0036	0.3793	5.0	8fdu:A, 7z8l:f
28	3ats:A	352	27	0.1294	0.0312	0.4074	5.3	3att:A
29	8ptk:f	4502	29	0.1294	0.0024	0.3793	5.9	8ptk:e
30	7z8f:e	4579	29	0.1294	0.0024	0.3793	6.1	5owo:A, 8pr2:f, 8ptk:m, 8ptk:n, 7z8f:f, 7z8f:m, 7z8f:n, 7z8h:A
31	2v43:A	261	25	0.1294	0.0421	0.4400	7.6
32	2v42:A	290	25	0.1294	0.0379	0.4400	7.8	3m4w:A, 3m4w:B, 2v42:B, 2v43:B
33	1p5j:A	319	27	0.1294	0.0345	0.4074	8.9
34	4cc5:A	308	48	0.1765	0.0487	0.3125	10.0	4cc6:A, 5fpo:A, 5fpr:A

[Back]