VKYTPMMLNIQNMMWWNGKRNLYRATYREKTWYEISRTGAFTKGRRPVMRQKYSREALQAALAMVPPGFEVADVPRPPQR
ILAQSEGIVGRWYSNYWTLHSMRYQCLLAGVEWPLGERQRPRTNYDEPFFFADFEESKAIRDYRSRWINVNRSLVGMTKR
MKEAEEEARYMQFRKLQDTFWSNRKVLVNRVKSMYN
The query sequence (length=196) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6hiv:Av | 213 | 193 | 0.9847 | 0.9061 | 1.0000 | 2.35e-145 | 7aoi:Av, 6hix:Av, 6yxx:Av, 6yxy:Av |
2 | 7aih:Ag | 231 | 197 | 0.7653 | 0.6494 | 0.7614 | 3.65e-113 | 7am2:Ag, 7ane:Ag |
3 | 3og2:A | 986 | 51 | 0.0867 | 0.0172 | 0.3333 | 0.69 | 3ogr:A, 3ogs:A, 3ogv:A |
4 | 6jp4:A | 770 | 60 | 0.0969 | 0.0247 | 0.3167 | 3.0 | 6jp4:B, 6jp4:C, 6jph:A, 6jpn:A |
5 | 1x77:A | 174 | 25 | 0.0612 | 0.0690 | 0.4800 | 5.1 | 1x77:B |
6 | 3p1v:A | 406 | 19 | 0.0510 | 0.0246 | 0.5263 | 9.7 | 3p1v:B |