VKWECPAGYEVKEGLNVDFPHKGMKRAFIVYPAKNVSGPAPVWVPMTGSVESTNDNLTVARSGANSILADHGYTVIAPVR
ACANQDPNIRGERCNGPGSNGWNWNPWFEGRAADPSGEHWKNDEGPDSSFFVAMVQCVGTKYKLDARRLFLGGIASGGTM
TNRALLFRSNFWAGGLPISGEWYVTSDDGTPLSFDDARAAVAAAPTKIHQGRVGPYPLPAKVGPLIVMTVWGGEKDLWNC
TRPDGSRFLCADYRPSTQAGSNFFSAQPDVVHVACSSTHGHMWPQLNTQEFNRWALDTLASHPKGSDPRSFKLTQPPEGY
TCHVGPFTGLYASAW
The query sequence (length=335) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3wl7:A | 336 | 335 | 0.9970 | 0.9940 | 0.9970 | 0.0 | 3wl8:A, 3wwc:A |
2 | 8jh8:A | 242 | 76 | 0.0687 | 0.0950 | 0.3026 | 0.004 | 8jh9:A |
3 | 3fcx:B | 275 | 153 | 0.1224 | 0.1491 | 0.2680 | 0.059 | 3fcx:A |
4 | 8iyb:A | 275 | 46 | 0.0507 | 0.0618 | 0.3696 | 0.26 | 8iyb:B, 8iyc:A, 8iyc:B |
5 | 3u57:A | 471 | 66 | 0.0537 | 0.0382 | 0.2727 | 1.3 | 4atl:A, 4atl:B, 4ek7:A, 4ek7:B, 3u57:B, 3u5y:A, 3u5y:B, 3zj6:A, 3zj6:B |
6 | 3iox:A | 489 | 75 | 0.0567 | 0.0389 | 0.2533 | 6.7 | 3ipk:A, 3ipk:B, 6ubv:A, 6ubv:B, 6ubv:C, 6ubv:D |