VKIYTKNGDKGQTRIIGKQILYKNDPRVAAYGEVDELNSWVGYTKSLINSHTQVLSNELEEIQQLLFDCGHDLATPADDE
RHSFKFKQEQPTVWLEEKIDNYTQVVPAVKKFILPGGTQLASALHVARTITRRAERQIVQLMREEQINQDVLIFINRLSD
YFFAAARYANYLEQQPDMLYRNSKDVFR
The query sequence (length=188) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3ci1:A | 188 | 188 | 1.0000 | 1.0000 | 1.0000 | 8.03e-142 | 3ci3:A, 3ci4:A, 3gah:A, 3gai:A, 3gaj:A, 2nt8:A, 2r6t:A, 2r6t:B, 2r6x:A, 2r6x:B |
2 | 3ke5:A | 182 | 185 | 0.4574 | 0.4725 | 0.4649 | 1.93e-48 | 3ke5:C, 3ke5:B |
3 | 7rut:E | 187 | 179 | 0.3777 | 0.3797 | 0.3966 | 7.38e-38 | 6d5k:A, 6d5k:C, 6d5k:B, 6d5x:A, 6d5x:C, 6d5x:B, 2idx:A, 2idx:C, 2idx:B, 7rut:D, 7rut:C, 7rut:F, 7rut:B, 7rut:A, 7ruu:A, 7ruu:C, 7ruu:B, 7ruu:D, 7ruv:A, 7ruv:D, 7ruv:B, 7ruv:C |
4 | 2zhz:B | 174 | 182 | 0.3617 | 0.3908 | 0.3736 | 9.89e-30 | 2zhz:A, 2zhz:C |
5 | 8d32:A | 186 | 183 | 0.3670 | 0.3710 | 0.3770 | 3.51e-28 | 6wgs:A, 6wgv:A, 6wh5:A, 6wh5:B, 6wh5:C |
6 | 2eix:A | 243 | 59 | 0.0798 | 0.0617 | 0.2542 | 0.53 | 2eix:B |
7 | 4o6m:B | 341 | 69 | 0.0904 | 0.0499 | 0.2464 | 3.0 | 4o6m:A, 4o6n:A, 4o6n:B, 4q7c:A, 4q7c:B |
8 | 1jq5:A | 366 | 78 | 0.1117 | 0.0574 | 0.2692 | 3.2 | 1jpu:A, 1jqa:A |
9 | 7dbe:B | 332 | 66 | 0.0957 | 0.0542 | 0.2727 | 9.1 | 7dbe:A, 7dbe:C, 7dbe:D, 7wud:B, 7wud:A, 7wud:C, 7wud:D |