VIVYGDYNNDGNVDSTDFAGLKKYIMAADHAYVKNLDVNLDNEVNAFDLAILKKYLLGMVSKLE
The query sequence (length=64) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2vn6:B | 64 | 64 | 1.0000 | 1.0000 | 1.0000 | 7.30e-40 | 2vn5:B, 2vn5:D |
2 | 4fl4:A | 68 | 65 | 0.4375 | 0.4118 | 0.4308 | 1.79e-11 | 4fl4:D, 4fl4:G, 4fl4:J |
3 | 1daq:A | 71 | 63 | 0.4219 | 0.3803 | 0.4286 | 8.52e-11 | 1dav:A, 2mte:A |
4 | 5nrk:B | 68 | 65 | 0.3281 | 0.3088 | 0.3231 | 5.00e-07 | 5nrk:D, 5nrm:B |
5 | 2ccl:B | 62 | 63 | 0.3438 | 0.3548 | 0.3492 | 2.66e-06 | 2ccl:D, 1ohz:B |
6 | 2ccl:B | 62 | 25 | 0.1562 | 0.1613 | 0.4000 | 5.5 | 2ccl:D, 1ohz:B |
7 | 4dh2:B | 72 | 69 | 0.4219 | 0.3750 | 0.3913 | 4.55e-06 | 4dh2:D |
8 | 3ul4:B | 63 | 62 | 0.3438 | 0.3492 | 0.3548 | 8.44e-06 | |
9 | 5lxv:B | 65 | 61 | 0.3125 | 0.3077 | 0.3279 | 2.51e-04 | 5lxv:D |
10 | 8x3a:A | 151 | 56 | 0.3281 | 0.1391 | 0.3750 | 4.12e-04 | 8x39:A, 8x39:B |
11 | 8x3a:A | 151 | 67 | 0.2656 | 0.1126 | 0.2537 | 0.63 | 8x39:A, 8x39:B |
12 | 5m0y:B | 157 | 36 | 0.2188 | 0.0892 | 0.3889 | 0.002 | 5k39:B |
13 | 6kg9:A | 67 | 56 | 0.3125 | 0.2985 | 0.3571 | 0.065 | 6kgc:B, 6kgd:B, 6kge:D, 6kge:B, 6kgf:D, 6kgf:B |
14 | 4idb:A | 321 | 50 | 0.2969 | 0.0592 | 0.3800 | 1.0 | 4idc:A, 4idd:A, 4ide:A, 4idf:A |
15 | 7yca:3 | 227 | 28 | 0.2031 | 0.0573 | 0.4643 | 2.0 | |
16 | 8i9x:LB | 356 | 74 | 0.3125 | 0.0562 | 0.2703 | 5.0 | 8i9r:LB, 8i9t:LB, 8i9v:LB, 8i9w:LB, 8i9y:LB, 8i9z:LB, 8ia0:LB |
17 | 8pv1:LB | 389 | 74 | 0.3125 | 0.0514 | 0.2703 | 5.0 | 7olc:LB, 7old:LB, 8oo0:LB, 8pv2:LB, 8pv3:LB, 8pv4:LB, 8pv5:LB, 8pv6:LB, 8pv7:LB, 8pv8:LB, 8pvk:LB, 8pvl:LB, 7r81:E1, 7z3n:LB, 7z3o:LB |
18 | 4uyp:B | 73 | 63 | 0.2344 | 0.2055 | 0.2381 | 5.7 | 4uyp:D, 4uyq:B |
19 | 5n5p:B | 87 | 20 | 0.1562 | 0.1149 | 0.5000 | 6.1 | 5n5p:D |
20 | 5n5p:B | 87 | 40 | 0.2500 | 0.1839 | 0.4000 | 7.0 | 5n5p:D |
21 | 5kkb:A | 469 | 62 | 0.2656 | 0.0362 | 0.2742 | 6.3 | 5kkb:B, 1nxc:A |
22 | 1ksi:A | 642 | 25 | 0.1562 | 0.0156 | 0.4000 | 7.0 | 1ksi:B, 1w2z:A, 1w2z:B, 1w2z:C, 1w2z:D |
23 | 5dnl:A | 176 | 30 | 0.1406 | 0.0511 | 0.3000 | 7.4 | 5dnl:C, 5dnl:B, 5dnx:A, 5dnx:C, 5dnx:B |
24 | 5mio:C | 477 | 43 | 0.2188 | 0.0294 | 0.3256 | 7.9 | 1v8j:A, 5xjb:A |
25 | 6ji2:A | 432 | 40 | 0.1875 | 0.0278 | 0.3000 | 9.2 | 4cxg:A, 4cxh:A, 6ji2:E, 3vmf:A, 3wxm:A, 3wxm:C, 3wxm:E, 3wxm:G |