VIPKGKPKSGRVWKDRSKKRFSQMLQDKPLRTSWQRKMKERQERKLAKD
The query sequence (length=49) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8fl2:NZ | 117 | 49 | 1.0000 | 0.4188 | 1.0000 | 1.31e-29 | 8fl0:NZ, 8fl3:NZ, 8fl4:NZ, 8ink:r, 8ipd:r, 8ipx:r, 8ipy:r |
2 | 2raf:A | 190 | 29 | 0.2245 | 0.0579 | 0.3793 | 0.96 | |
3 | 8b5q:B | 365 | 23 | 0.1633 | 0.0219 | 0.3478 | 2.5 | 8b5q:A, 8b5s:A, 8b5s:B, 8b62:A, 8b62:B, 8b63:A, 8b63:B |
4 | 5hs2:A | 226 | 24 | 0.1633 | 0.0354 | 0.3333 | 3.1 | |
5 | 6x6x:A | 417 | 30 | 0.2449 | 0.0288 | 0.4000 | 3.8 | 2wn6:A, 2wn7:A, 6x6r:A, 6x6r:B, 6x6v:A, 6x6v:B, 6x6v:C, 6x6v:D, 6x6x:B |
6 | 3gqc:B | 440 | 31 | 0.2449 | 0.0273 | 0.3871 | 6.3 | 3gqc:A, 3gqc:D, 3gqc:C |
7 | 3izy:P | 537 | 42 | 0.3265 | 0.0298 | 0.3810 | 8.2 | |
8 | 6agi:B | 322 | 24 | 0.2041 | 0.0311 | 0.4167 | 8.8 | 6agi:A |