VILTQLNEDGTTSNYFDKRKLKIAPRSTLQFKVGPPFELVRDYCPVVESHTGRTLDLRIIPRIDRGFDHIDEEWVGYKRN
YFTLVSTFETANCDLDTFLKSSFDLLVEDSSVEGRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKGPQFCPSVCPLVP
SPLPKHQTIREASNVRNITKMKKYDSTFYLHRDHVNYEEYGVDSLLFSYPEDSIQKVARYERVQFASSISVKKPSQQNKH
FSLHVILGAVVDPDPGIPYDELALKNGSKGMFVYLQEMKTPPLIIRGRSPSNYASSQ
The query sequence (length=297) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2etw:A | 297 | 297 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 2euv:A, 2euw:A, 2eux:A, 2euz:A, 2evf:A, 2evg:A, 2evh:A, 2evi:A, 2evj:A, 1mnn:A |
2 | 4bxd:A | 255 | 82 | 0.0707 | 0.0824 | 0.2561 | 1.9 | 4bxd:B, 4bxe:A, 4bxe:B |
3 | 6lvb:A | 762 | 49 | 0.0572 | 0.0223 | 0.3469 | 5.7 | 6lvb:C, 6lvb:E, 6lvb:G, 6lvc:A, 6lvc:C, 6lvv:A, 6lvv:C, 6lvv:E, 6lvv:G, 6lvv:I, 6lvv:K, 6lvv:M, 6lvv:O, 7w8j:A, 7w8j:C, 7w8j:E, 7w8j:G |