VHKMALLVPFRDRFEELLQFVPHMTAFLKRQGVAHHIFVLNQVDRFRFNRASLINVGFQFASDVYDYIAMHDVDLLPLND
NLLYEYPSSLGPLHIAGPKLHPKYHYDNFVGGILLVRREHFKQMNGMSNQYWGWGLENDEFFVRIRDAGLQVTRPQNIKT
GTNDTFSHIHNRYHRKRDTQKCFNQKEMTRKRDHKTGLDNVKYKILKVHEMLIDQVPVTILNILLDCDVNKTPWCDCS
The query sequence (length=238) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4lw3:A | 242 | 238 | 1.0000 | 0.9835 | 1.0000 | 0.0 | 3lw6:A, 4lw6:A, 4m4k:A |
2 | 4irq:C | 249 | 237 | 0.5588 | 0.5341 | 0.5612 | 1.14e-96 | 4irp:A, 4irq:A, 4irq:B, 4irq:D |
3 | 4irp:B | 227 | 237 | 0.5210 | 0.5463 | 0.5232 | 3.02e-86 | |
4 | 2agd:A | 273 | 223 | 0.3277 | 0.2857 | 0.3498 | 8.67e-35 | 2ae7:A, 2ae7:B, 2ae7:C, 2aec:A, 2aec:B, 2aec:C, 2aes:A, 2aes:B, 2aes:C, 2agd:B, 2agd:C, 2ah9:A, 2ah9:B, 2ah9:C, 3ee5:A, 3ee5:B, 3ee5:C, 4ee3:A, 4ee3:B, 4ee3:C, 4ee4:A, 4ee4:B, 4ee4:C, 4ee5:A, 4ee5:B, 4ee5:C, 4eea:A, 4eea:B, 4eea:C, 4eeg:A, 4eeg:B, 4eeg:C, 4eem:A, 4eem:B, 4eem:C, 4eeo:A, 4eeo:B, 4eeo:C, 2fya:A, 2fyb:A, 2fyc:B, 2fyc:D, 4krv:A, 4krv:B, 1o0r:A, 1o0r:B, 1tvy:A, 1tvy:B, 1tw1:A, 1tw1:B, 1tw5:A, 1tw5:B |
5 | 1fgx:B | 273 | 210 | 0.2941 | 0.2564 | 0.3333 | 4.73e-33 | 1fr8:A, 1fr8:B, 2fyd:B, 2fyd:D, 1nf5:B, 1nf5:D, 1nhe:B, 1nhe:D, 1nkh:B, 1nkh:D, 1nwg:B, 1nwg:D, 1o23:B, 1o23:D, 1oqm:B, 1oqm:D, 1pzy:B, 1pzy:D, 1yro:B, 1yro:D |
6 | 6s24:A | 537 | 45 | 0.0504 | 0.0223 | 0.2667 | 1.5 | 6s22:A |
7 | 6pxu:B | 532 | 42 | 0.0546 | 0.0244 | 0.3095 | 4.3 | 6pxu:A |
8 | 4c3s:A | 435 | 49 | 0.0630 | 0.0345 | 0.3061 | 7.0 | 5dbv:A |
9 | 3c3d:A | 306 | 38 | 0.0546 | 0.0425 | 0.3421 | 8.3 | 3c3d:B, 3c3d:C, 3c3d:D, 3c3e:A, 3c3e:B, 3c3e:C, 3c3e:D |
10 | 4icm:A | 335 | 60 | 0.0756 | 0.0537 | 0.3000 | 9.5 | 4icm:B, 4icm:C, 4icm:D, 4icm:E, 4icm:F, 4icm:G, 4icm:H, 4l6d:A, 4l6d:B, 4l6d:C, 4l6d:D, 4l6d:E, 4l6d:F, 4l6d:G, 4l6d:H, 4ng3:A, 4ng3:B, 4ng3:C, 4ng3:D, 4ng3:E, 4ng3:F, 4ng3:G, 4ng3:H, 4ni8:A, 4ni8:B, 4ni8:C, 4ni8:D, 4ni8:E, 4ni8:F, 4ni8:G, 4ni8:H |
11 | 6a52:B | 125 | 43 | 0.0714 | 0.1360 | 0.3953 | 9.8 | 6a52:A |