VGYTPVNPDTSPMVAYSQYHWHYNLPQGMERPHSVNRTFAAPFQSNHSLVNKYRGVWIEFDMHPAFSVALEPQLRKLPRG
RTLPKTPAEEVIADYTALAPLVDDEKTRDLWLAKVFQHCAFQRCGGAMELWERYCHQRFTAEGATAKPPLSLVKSVLFYC
NKTDNSGWRALFDRCLKDGWNYTPLFDTAQWSFMLKSIGRMGDEDGVRAVLEEMLDVQADLDRVEARSVVIALNAVTNAD
VYEFVKKYLFNFGERKVKFLRTTYSDLRGHGAGKLRIPLKENDNMYYHVCWHSSIRSPRQFSPRQLYFDYTPSTL
The query sequence (length=315) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7pub:DJ | 357 | 315 | 1.0000 | 0.8824 | 1.0000 | 0.0 | 6hiv:DJ, 6hiw:DJ, 6hiz:DJ, 7pua:DJ, 6sg9:DJ, 6sgb:DJ |
2 | 7aor:aj | 315 | 315 | 0.8000 | 0.8000 | 0.8000 | 0.0 | |
3 | 7ane:aj | 316 | 316 | 0.6889 | 0.6867 | 0.6867 | 1.27e-172 | |
4 | 4q86:B | 583 | 46 | 0.0571 | 0.0309 | 0.3913 | 2.7 | 4q85:A, 4q85:B, 4q85:C, 4q85:D, 4q85:E, 4q85:G, 4q85:H, 4q86:A, 4q86:C, 4q86:D, 4q86:E, 4q86:G, 4q86:H |
5 | 4ijr:A | 328 | 58 | 0.0571 | 0.0549 | 0.3103 | 4.4 | 4ijr:C |
6 | 2rio:A | 396 | 34 | 0.0476 | 0.0379 | 0.4412 | 6.3 | 2rio:B |
7 | 6zhm:A | 269 | 47 | 0.0413 | 0.0483 | 0.2766 | 6.9 | 6zhl:A, 6zjo:A, 6zjo:B |
8 | 7c5o:O | 338 | 59 | 0.0508 | 0.0473 | 0.2712 | 8.6 | 7c5f:O, 7c5f:P, 7c5f:Q, 7c5f:R, 7c5g:O, 7c5g:P, 7c5g:Q, 7c5g:R, 7c5h:O, 7c5h:P, 7c5h:Q, 7c5h:R, 7c5i:O, 7c5i:P, 7c5i:Q, 7c5i:R, 7c5j:O, 7c5j:P, 7c5j:Q, 7c5j:R, 7c5k:O, 7c5k:P, 7c5k:Q, 7c5k:R, 7c5l:O, 7c5l:P, 7c5l:Q, 7c5l:R, 7c5m:O, 7c5m:P, 7c5m:Q, 7c5m:R, 7c5n:O, 7c5n:P, 7c5n:Q, 7c5n:R, 7c5o:P, 7c5o:Q, 7c5o:R, 7c5p:O, 7c5p:P, 7c5p:Q, 7c5p:R, 7c5q:O, 7c5q:P, 7c5q:Q, 7c5q:R, 7c5r:O, 7c5r:P, 7c5r:Q, 7c5r:R, 7c7k:O, 7c7k:P, 7c7k:Q, 7c7k:R |