VGERFTHDFVVPPHKTVRHLYPESPEFAEAPEVFATGFMVGLMEWACVRAMAPYLEPGEGSLGTAICVTHTAATPPGLTV
TVTAELRSVEGRRLSWRVSAHDGVDEIGSGTHERAVIHLEKFNAKVRQKTP
The query sequence (length=131) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3p3i:A | 135 | 130 | 0.9924 | 0.9630 | 1.0000 | 1.18e-93 | 3kuv:B, 3kuv:A, 3kuw:B, 3kuw:A, 3kv7:B, 3kv7:A, 3kv8:A, 3kv8:B, 3kvi:B, 3kvi:A, 3kvu:A, 3kvu:B, 3kvu:C, 3kvu:D, 3kvz:A, 3kvz:B, 3kvz:E, 3kvz:F, 3kw1:C, 3kw1:D, 3kw1:E, 3kw1:F, 3p2r:A, 3p2r:B, 3p3i:B, 3p3i:C, 3p3i:D |
2 | 8tri:C | 419 | 28 | 0.0916 | 0.0286 | 0.4286 | 3.1 | |
3 | 8tri:B | 454 | 28 | 0.0916 | 0.0264 | 0.4286 | 3.4 | 7suu:A, 7suu:B, 8tri:A |
4 | 7zc6:G | 187 | 37 | 0.0763 | 0.0535 | 0.2703 | 5.2 | |
5 | 4lxc:A | 246 | 32 | 0.0916 | 0.0488 | 0.3750 | 7.0 | 5leo:B, 5leo:A, 4lxc:B, 4lxc:C, 4lxc:D, 5nmy:A, 4qp5:A, 4qp5:B, 4qpb:A, 4qpb:B, 6rje:A, 6rk4:A |