Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
VFQLVCSTCGKDISHERYKLIIRKKSLKDVLVSVKNECCRLKLSTQIEPQRNLTVQPLLDI

The query sequence (length=61) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 7amv:J 61 61 1.0000 1.0000 1.0000 5.11e-39 7aoh:J, 8p0j:J, 8p0k:J, 8p0n:J, 6ric:J, 6rid:J, 6rie:J
2 1rzr:G 332 20 0.1639 0.0301 0.5000 1.3 2jcg:A, 2nzu:G, 2nzv:G, 1rzr:C, 1rzr:A, 1rzr:D, 1sxg:B, 1zvv:A, 1zvv:B, 1zvv:G
3 9bct:N 65 48 0.2623 0.2462 0.3333 1.7 9bcu:N, 6kf4:N, 4qiw:N, 4qiw:V
4 4n0l:A 335 18 0.1311 0.0239 0.4444 3.6 4n0l:B
5 8cro:N 65 48 0.2623 0.2462 0.3333 3.6 8oki:N, 8orq:N, 8p2i:N, 8rbo:N
6 6sga:FC 311 30 0.1639 0.0322 0.3333 6.2 6sgb:FC
7 6sga:FB 377 30 0.1639 0.0265 0.3333 6.3 6sgb:FB
8 6ut5:A 395 27 0.1803 0.0278 0.4074 8.3 6ut3:C, 6ut3:D, 6ut3:E, 6ut3:F, 6ut4:A, 6ut4:B, 6ut4:C, 6ut4:D, 6ut4:E, 6ut4:F, 6ut5:B, 6ut5:C, 6ut5:D, 6ut5:E, 6ut5:F, 6ut7:A, 6ut7:B, 6ut7:C, 6ut7:D, 6ut7:E, 6ut7:F, 6ut7:H, 6ut7:I, 6ut7:J, 6ut7:K, 6ut7:L, 6ut7:M, 6ut8:A, 6ut8:B, 6ut8:C, 6ut8:D, 6ut8:E, 6ut8:F
9 2p0j:A 203 34 0.1475 0.0443 0.2647 8.3 2p0j:B, 1vrr:A, 1vrr:B

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218