VFLCPGLLKGVYQSEHLFESDHQSGAWCKDPLQASDKIYYMPWTPYRTDTLTEYSSKDDFIAGRPTTTYKLPHRVDGTGF
VVYDGALFFNKERTRNIVKFDLRTRIKSGEAIIANANYHDTSPYRWGGKSDIDLAVDENGLWVIYATEQNNGKIVISQLN
PYTLRIEGTWDTAYDKRSASNAFMICGILYVVKSVGNKIDYIYNTDQSKDSLVDVPFPNSYQYIAAVDYNPRDNLLYVWN
NYHVVKYSLDFGPL
The query sequence (length=254) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5ftt:G | 368 | 263 | 1.0000 | 0.6902 | 0.9658 | 0.0 | 5afb:A, 5cmn:E, 5cmn:F, 5cmn:G, 5cmn:H, 5ftt:C, 5ftt:D, 5ftt:H, 5ftu:C, 5ftu:D, 5ftu:G, 5ftu:H, 5ftu:K, 5ftu:L, 4rmk:A, 4rml:A, 4yeb:A |
2 | 6ska:D | 347 | 251 | 0.7205 | 0.5274 | 0.7291 | 8.07e-143 | 2jxa:A |
3 | 6qm3:A | 268 | 251 | 0.4291 | 0.4067 | 0.4343 | 7.17e-66 | 6qhj:A, 6qm3:B, 4xat:A |
4 | 6ou1:A | 260 | 238 | 0.3898 | 0.3808 | 0.4160 | 5.27e-62 | 8frr:A, 6ou1:B, 7sib:A, 7sij:A, 7sjt:A, 7sju:A, 7sjv:A, 7sjw:A, 7skd:A, 7ske:A, 7skf:A, 7skg:A, 7t8d:A, 4wxq:A, 4wxs:A, 4wxu:A |
5 | 6nax:A | 259 | 237 | 0.3740 | 0.3668 | 0.4008 | 7.81e-60 | 6nax:B |
6 | 3vyw:D | 306 | 54 | 0.0866 | 0.0719 | 0.4074 | 0.37 | 3vyw:A, 3vyw:B, 3vyw:C |
7 | 3hxg:A | 183 | 92 | 0.0906 | 0.1257 | 0.2500 | 0.77 | 3hxi:A |
8 | 1wb7:A | 205 | 94 | 0.1181 | 0.1463 | 0.3191 | 2.0 | 1wb7:B, 1wb8:A, 1wb8:B |
9 | 3ano:B | 175 | 49 | 0.0669 | 0.0971 | 0.3469 | 2.7 |