VEYTNTFKVAAVQAQPVWFDAAKTVDKTVSNIAEAARNGCELVAFPEVFIPGYPYHIWVDSPLAGMAKFAVRYHENSLTM
DSPHVQRLLDAARDHNIAVVVGISERDGGSLYMTQLIIDADGQLVARRRKLKPTHVERSVYGEGNGSDISVYDMPFARLG
ALNCWEHFQTLTKYAMYSMHEQVHVASWPGMSLYQPEVPAFGVDAQLTATRMYALEGQTFVVCTTQVVTPEAHEFFCENE
EQRKLIGRGGGFARIIGPDGRDLATPLAEDEEGILYADIDLSAITLAKQAADPVGHYSRPDVLSLNFNQRRTTPVNT
The query sequence (length=317) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8uxu:A | 317 | 317 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 8uxu:B, 8uxu:C, 8uxu:D, 8uxu:E, 8uxu:F, 8uxu:G, 8uxu:H, 8uxu:I, 8uxu:J, 8uxu:K, 8uxu:L, 8uxu:M, 8uxu:N |
2 | 3klc:A | 261 | 277 | 0.2208 | 0.2682 | 0.2527 | 2.80e-14 | 3klc:B |
3 | 6ypa:B | 269 | 168 | 0.1293 | 0.1524 | 0.2440 | 2.90e-09 | 7ovg:A, 7ovg:B, 6ypa:A, 6ypa:C, 6ypa:D |
4 | 5h8i:C | 301 | 239 | 0.1640 | 0.1728 | 0.2176 | 5.99e-04 | 5h8i:B, 5h8i:D, 5h8i:E, 5h8i:F, 5h8i:G, 5h8i:J, 5h8i:K, 5h8i:L, 5h8i:M, 5h8i:N, 5h8i:O, 5h8j:B, 5h8j:C, 5h8j:D, 5h8j:E, 5h8j:F, 5h8j:G, 5h8j:J, 5h8j:K, 5h8j:L, 5h8j:M, 5h8j:N, 5h8j:O, 5h8l:B, 5h8l:C, 5h8l:D, 5h8l:E, 5h8l:F, 5h8l:G, 5h8l:J, 5h8l:K, 5h8l:L, 5h8l:M, 5h8l:N, 5h8l:O |
5 | 2e2l:A | 317 | 136 | 0.1104 | 0.1104 | 0.2574 | 0.003 | 2e2l:C, 2e2l:F |
6 | 4cyg:A | 463 | 164 | 0.1136 | 0.0778 | 0.2195 | 0.029 | 4cyg:B, 7slv:A, 7slx:A, 7sly:A |
7 | 8hpc:C | 303 | 153 | 0.1136 | 0.1188 | 0.2353 | 0.029 | 8hpc:A, 8hpc:B, 8hpc:D, 8hpc:E, 8hpc:F, 8hpc:G, 8hpc:H, 1uf5:A, 1uf5:B, 1uf7:A, 1uf7:B, 1uf8:A, 1uf8:B |
8 | 5k61:A | 431 | 163 | 0.0978 | 0.0719 | 0.1902 | 0.089 | 5b62:A, 5k60:A, 5k62:A, 5k63:A, 5k66:A |
9 | 5kha:A | 526 | 49 | 0.0473 | 0.0285 | 0.3061 | 0.17 | 5kha:B |
10 | 8ebc:C | 355 | 92 | 0.0599 | 0.0535 | 0.2065 | 0.73 | 8ebc:A, 8ebc:B, 8ebc:D, 8ebc:F, 8ebc:E |
11 | 4gyl:A | 340 | 46 | 0.0536 | 0.0500 | 0.3696 | 3.1 | 4gyn:A, 4kzf:A |
12 | 8wov:B | 341 | 73 | 0.0694 | 0.0645 | 0.3014 | 3.9 | 8wop:A, 8wop:B, 8wov:A, 8wow:A, 8wow:B |
13 | 8cg5:A | 1282 | 25 | 0.0410 | 0.0101 | 0.5200 | 9.4 | 6fij:B |
14 | 8cg6:A | 1208 | 25 | 0.0410 | 0.0108 | 0.5200 | 9.4 | |
15 | 4tvr:A | 222 | 52 | 0.0442 | 0.0631 | 0.2692 | 9.8 |