VEVEHWNTLRLRIYIGENDKWEGRPLYKVIVEKLREMGIAGATVYRGIYGFGKIRLSTDLPIIVEVVDRGHNIEKVVNVI
KPMIKDGMITVEPTIVL
The query sequence (length=97) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2dcl:A | 99 | 97 | 0.9485 | 0.9293 | 0.9485 | 3.87e-59 | 2dcl:C, 2dcl:B |
2 | 1o51:A | 89 | 79 | 0.3505 | 0.3820 | 0.4304 | 1.90e-16 | |
3 | 7mfm:G | 1483 | 60 | 0.1856 | 0.0121 | 0.3000 | 5.2 | 7mfm:H, 7mft:G |
4 | 6mfv:A | 641 | 43 | 0.1649 | 0.0250 | 0.3721 | 6.3 | 6mfv:B, 6mfv:C, 6mfv:D |
5 | 6es9:A | 545 | 42 | 0.1340 | 0.0239 | 0.3095 | 7.7 | 6es9:B |
6 | 3pya:A | 688 | 16 | 0.0928 | 0.0131 | 0.5625 | 7.9 | 4lix:A, 3pyb:A |
7 | 5ups:A | 520 | 38 | 0.1031 | 0.0192 | 0.2632 | 8.5 | 5upq:A, 5upq:B, 5ups:B, 5upt:A |
8 | 2vl4:B | 841 | 47 | 0.1649 | 0.0190 | 0.3404 | 8.8 | 7op6:A, 7op6:B, 7op7:A, 7op7:B, 2vjx:A, 2vjx:B, 2vl4:A, 2vmf:A, 2vmf:B, 2vo5:A, 2vo5:B, 2vot:A, 2vot:B, 2vqt:A, 2vqt:B, 2vqu:A, 2vqu:B, 2vr4:A, 2vr4:B, 2wbk:A, 2wbk:B |
9 | 5k8b:A | 394 | 32 | 0.1031 | 0.0254 | 0.3125 | 9.7 | 5k8b:B, 5k8b:C, 5k8b:D |