VDPFYYDYETVRNGGLIFAALAFIVGLIIILSK
The query sequence (length=33) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8jbk:G | 36 | 33 | 1.0000 | 0.9167 | 1.0000 | 1.11e-17 | 7d91:G, 7d93:E, 7d93:G, 7d94:G, 7d94:E, 7ddf:G, 7ddf:E, 7ddh:G, 7ddh:E, 7ddi:G, 7ddi:E, 7ddk:E, 7ddl:G, 7ddl:E, 4hyt:G, 4hyt:E, 8jbk:E, 8jbl:G, 8jbl:E, 8jbm:G, 8jbm:E, 7qtv:G, 7qtv:E, 4res:G, 4res:E, 4ret:G, 4ret:E, 3wgu:G, 3wgu:E, 3wgv:G, 3wgv:E, 7wys:G, 7wys:E, 7wyt:G, 7wyt:E, 4xe5:G |
2 | 7e20:C | 33 | 32 | 0.8485 | 0.8485 | 0.8750 | 2.15e-15 | 7e1z:C, 7e21:C |
3 | 8jfz:E | 40 | 31 | 0.4242 | 0.3500 | 0.4516 | 0.017 | 8jfz:G, 7wyu:G, 7wyu:E, 7wyz:G, 7wyz:E |
4 | 3aou:A | 156 | 22 | 0.3030 | 0.0641 | 0.4545 | 2.4 | 3aou:B, 3aou:C, 3aou:D, 3aou:E, 3aou:F, 3aou:G, 3aou:H, 3aou:I, 3aou:J, 2bl2:A, 2bl2:B, 2bl2:C, 2bl2:D, 2bl2:E, 2bl2:F, 2bl2:G, 2bl2:H, 2bl2:I, 2bl2:J, 2db4:A, 2db4:B, 2db4:C, 2db4:D, 2db4:E, 2db4:F, 2db4:G, 2db4:H, 2db4:I, 2db4:J |
5 | 2ism:B | 333 | 15 | 0.2424 | 0.0240 | 0.5333 | 5.9 | 2ism:A |
6 | 7sa3:B | 450 | 23 | 0.2424 | 0.0178 | 0.3478 | 9.1 | |
7 | 8eqm:B | 483 | 23 | 0.2424 | 0.0166 | 0.3478 | 9.3 | 8eqm:b |