Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
VDGDSITSTEEIPFDKKREFDPNLAPGTEKVVQKGEPGTKTITTPTTKNPLTGEKVGEGEPTEKITKQPVDEIVHYGGEQ
IPQGHKDEFDPNAPVDSKTEVPGKPGVKNPDTGEVVTPPVDDVTKYGPVDGDSITSTEEIPFDKKREFDPNLAPGTEKVV
QKGEPGTKTITTPTTKNPLTGEKVGEGKSTEKVTKQPVDEIVEYGP

The query sequence (length=206) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 4fun:A 206 206 1.0000 1.0000 1.0000 9.66e-140 4fum:A, 4fuo:A, 4fup:A, 4fup:B
2 8deo:A 454 205 0.8544 0.3877 0.8585 5.92e-107 8deo:B, 8g1l:A, 7sie:A
3 8deo:A 454 128 0.3058 0.1388 0.4922 7.04e-24 8deo:B, 8g1l:A, 7sie:A
4 3tiq:B 214 197 0.6165 0.5935 0.6447 4.20e-85 3tiq:A
5 3tiq:B 214 79 0.2379 0.2290 0.6203 6.33e-25 3tiq:A
6 4xev:A 148 87 0.1019 0.1419 0.2414 2.1 3gm1:A, 3gm1:B, 4r32:A, 3u3f:A, 3u3f:B, 3u3f:C, 3u3f:D, 4xef:A, 4xef:D, 4xek:A, 4xev:D
7 3a09:A 490 93 0.1311 0.0551 0.2903 3.7 3vlu:A, 3vlv:A, 3vlw:A, 3vlw:B, 1y3n:A, 1y3p:A, 1y3q:A
8 4r43:A 601 21 0.0485 0.0166 0.4762 9.1 5i67:A, 4rcg:A, 4wie:A, 4wiu:A, 4wl8:A, 4wou:A, 4wpt:A, 4wpu:A, 4wpv:A

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218