VDGDPITSTEEIPFDKKREFDPNLAPGTEKVVQKGEPGTKTITTPTTKNPLTGEKVEGEPTEKITKQPVDEIVHYGGEQI
PQGHKDEFDPNAPVDSKTEVPGKPGVKNPDTGEVVTPPVDDVTKYGPVDGDSITSTEEIPFDKKREFDPNLAPGTEKVVQ
KGEPGTKTITTPTTKNPLTGEKVGEGKSTEKVTKQPVDEIVEYGPT
The query sequence (length=206) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4fun:A | 206 | 206 | 0.9903 | 0.9903 | 0.9903 | 3.99e-136 | 4fum:A, 4fuo:A, 4fup:A, 4fup:B |
2 | 8deo:A | 454 | 205 | 0.8544 | 0.3877 | 0.8585 | 1.58e-105 | 8deo:B, 8g1l:A, 7sie:A |
3 | 8deo:A | 454 | 128 | 0.3058 | 0.1388 | 0.4922 | 8.34e-24 | 8deo:B, 8g1l:A, 7sie:A |
4 | 3tiq:B | 214 | 197 | 0.6165 | 0.5935 | 0.6447 | 4.34e-83 | 3tiq:A |
5 | 3tiq:B | 214 | 79 | 0.2330 | 0.2243 | 0.6076 | 3.22e-22 | 3tiq:A |
6 | 4xev:A | 148 | 87 | 0.1019 | 0.1419 | 0.2414 | 1.9 | 3gm1:A, 3gm1:B, 4r32:A, 3u3f:A, 3u3f:B, 3u3f:C, 3u3f:D, 4xef:A, 4xef:D, 4xek:A, 4xev:D |
7 | 7wrx:H | 594 | 111 | 0.1408 | 0.0488 | 0.2613 | 2.1 | 7wrx:A, 7wrx:B, 7wrx:C, 7wrx:D, 7wrx:E, 7wrx:F, 7wrx:G, 7wrx:I, 7wrx:J, 7wrx:K, 7wrx:L |
8 | 3a09:A | 490 | 92 | 0.1262 | 0.0531 | 0.2826 | 2.4 | 3vlu:A, 3vlv:A, 3vlw:A, 3vlw:B, 1y3n:A, 1y3p:A, 1y3q:A |
9 | 4r43:A | 601 | 21 | 0.0485 | 0.0166 | 0.4762 | 9.4 | 5i67:A, 4rcg:A, 4wie:A, 4wiu:A, 4wl8:A, 4wou:A, 4wpt:A, 4wpu:A, 4wpv:A |