BioLiP

>protein
VAVPKIEMNFLNKPIVPDTTKVISNFLTHYLITEPVEHVEIEAKLGTLIDLETQNRFEFPVMNETILNPEFNLRTRFESD
MTASEHKYLNEFLNQAFRDSQKPGRLPFAYKHTKQVDLFYETEDKIRVSKNQSDNQVLACVKKRRVADLFLYCPNDAFDI
RISISDELPVSMPSGNQQPSLTRLKDRVGYVHQEIKIDLTKTTQNDPVYDTTERHELEVEFGNIADLRDRAQKAKDGMEA
PLFRRVQLFMDNVRILRREHS

The query sequence (length=261) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4pn1:B	261	261	1.0000	1.0000	1.0000	0.0	4pn1:A, 4pn1:C, 4pn1:D
2	1d8h:A	288	273	0.3218	0.2917	0.3077	1.10e-19	1d8h:B, 1d8h:C, 1d8i:A, 1d8i:B, 1d8i:C
3	6l7x:A	203	114	0.1034	0.1330	0.2368	6.80e-04	6l7w:A, 6l7y:A
4	6l7v:A	180	170	0.1379	0.2000	0.2118	0.007	6l7w:B
5	5xs2:A	366	53	0.0651	0.0464	0.3208	1.7	5cei:A, 5hbe:A, 5icp:A, 5idp:A, 6r3s:A, 6t41:A, 6y0a:A
6	6qf7:B	244	25	0.0460	0.0492	0.4800	1.9	6b74:B, 6b77:B, 6l63:A, 6l63:C, 6qf7:D, 8r8d:B, 8r8d:A, 6x0s:A, 6x0s:B, 6x0s:C, 6x0t:A, 6x0t:B, 6x0t:C
7	8tun:C	258	88	0.0843	0.0853	0.2500	3.0	8tt3:C, 8tt3:D, 8tun:D
8	1h3d:A	288	69	0.0728	0.0660	0.2754	3.1	1q1k:A
9	5brp:A	555	86	0.0766	0.0360	0.2326	4.4	5brp:B, 5brp:C, 5brp:D, 5brq:A, 5brq:B, 5brq:C, 5brq:D
10	6ayi:A	183	102	0.0805	0.1148	0.2059	5.7	6ayi:B, 6ayi:C, 6ayi:D
11	8jhz:A	2615	63	0.0766	0.0076	0.3175	9.6

[Back]