VANYQIKVLDDGKIDKSATESPANNDVQLKVYAVDANGNIVGDITNDVTITSEATDTNGVIVNASKSTANGDTVYVITDN
GSKKVGKETLTVKLGTVTLGTVDVEVIDTTLKATVVTKKADLIELDAADNGDALAKLLANLDIKDQNGNPMVDSAATPNT
NEKLQALKSVLSGIVSSDTSVIGSVSNVDNLKDDASISGLAVKKAGTVTLTLVFNEDSKIAPIAITVKAPAA
The query sequence (length=232) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5ftx:A | 651 | 232 | 1.0000 | 0.3564 | 1.0000 | 9.59e-153 | 5fty:A, 5fty:B, 4uie:A, 4uj7:A, 4uj8:A, 4uj8:B, 4uj8:C, 4uj8:D |
2 | 1arc:A | 263 | 64 | 0.0948 | 0.0837 | 0.3438 | 0.27 | |
3 | 3vwd:A | 196 | 103 | 0.1034 | 0.1224 | 0.2330 | 1.9 | 4b5o:A, 4b5p:A, 4b5p:B, 4gs4:A, 4if5:A, 4pk2:A, 4pk3:A, 4u9y:A, 4u9z:A, 3vwe:A |
4 | 2wvk:A | 391 | 35 | 0.0560 | 0.0332 | 0.3714 | 3.6 | 2wvk:B, 2wvl:A, 2wvl:B, 2wvm:A, 2wvm:B |
5 | 1rwc:A | 754 | 47 | 0.0862 | 0.0265 | 0.4255 | 7.6 | 1rwf:A, 1rwg:A, 1rwh:A |