VAKQRIRMANEKHSKNITQRGNVAKTSRNAP
The query sequence (length=31) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 8rjb:4 | 62 | 30 | 0.9677 | 0.4839 | 1.0000 | 1.94e-15 | 8rjc:4, 8rjd:4 |
| 2 | 6nbq:K | 212 | 28 | 0.3871 | 0.0566 | 0.4286 | 1.1 | 6hum:K, 6khi:K, 6khj:K, 6l7o:K, 6l7p:K, 6nbx:K, 6nby:K, 6tjv:K |
umich.edu