VAGAVIDGAGLGFDVLKTVLEALGNVKRKIAVGIDNESGKTWTAMNTYFRSGTSDIVLPHKVAHGKALLYNGQKNRGPVA
TGVVGVIAYSMSDGNTLAVLFSVPYDYNWYSNWWNVRVYKGQKRADQRMYEELYYHRSPFRGDNGWHSRGLGYGLKSRGF
MNSSGHAILEIHVTKA
The query sequence (length=176) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4tsl:A | 178 | 176 | 1.0000 | 0.9888 | 1.0000 | 1.08e-129 | 5gwf:B, 5gwf:D, 4tsl:B, 4tsn:A, 4tsn:B, 4tsn:C, 4tsn:D, 4tso:A, 4tso:B, 4tsp:A, 4tsp:B, 4tsq:A, 4tsq:E, 4tsq:B, 4tsq:C, 4tsq:D, 4tsq:F, 4tsy:A, 4tsy:B, 4tsy:C, 4tsy:D |
2 | 1o72:A | 175 | 175 | 0.6250 | 0.6286 | 0.6286 | 4.88e-82 | 1o72:B |
3 | 3gbf:A | 415 | 40 | 0.0852 | 0.0361 | 0.3750 | 2.2 | |
4 | 9b1l:A | 529 | 33 | 0.0568 | 0.0189 | 0.3030 | 4.1 | 9b1g:A, 9b1h:A, 9b1i:A, 9b1j:A, 9b1k:A, 9b1m:A, 9b1n:A, 9b1o:A |
5 | 6lce:A | 407 | 72 | 0.1307 | 0.0565 | 0.3194 | 5.8 | 6lcf:A, 6lcf:B |
6 | 3vyt:C | 336 | 34 | 0.0739 | 0.0387 | 0.3824 | 8.6 | 3vys:C, 3wjp:A, 3wjq:A, 3wjr:A |