TYSSLPDDYNCKVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNIEETHDLVLKTRLEEKGEHLEQGPMIEQLSK
MFFTTKHRWYPRGQYHRRRRKPNPPKDR
The query sequence (length=108) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6gaw:Bf | 108 | 108 | 1.0000 | 1.0000 | 1.0000 | 3.26e-78 | 6gb2:Bf, 7nqh:Bf, 7nql:Bf, 7nsh:Bf, 7nsi:Bf, 7nsj:Bf, 8oin:Br, 8oiq:Br, 6ydp:Bf, 6ydw:Bf |
2 | 7l08:a | 108 | 108 | 0.8889 | 0.8889 | 0.8889 | 2.12e-67 | 8any:a, 3j7y:a, 7l20:a, 7odr:a, 7ods:a, 7odt:a, 8oir:Br, 8oit:Br, 8pk0:a, 7po4:a, 7qi4:a, 7qi5:a, 7qi6:a, 8qsj:a, 6vlz:a, 6vmi:a, 6zm5:a, 6zm6:a |
3 | 8k2a:Lp | 97 | 108 | 0.7963 | 0.8866 | 0.7963 | 1.47e-56 | 8k2b:Lp, 7og4:a, 8xt0:Lp, 8xt1:Lp, 8xt2:Lp, 8xt3:Lp, 6zs9:a, 6zsa:a, 6zsb:a, 6zsc:a, 6zsd:a, 6zse:a, 6zsg:a |
4 | 5aj4:Bf | 108 | 108 | 0.7963 | 0.7963 | 0.7963 | 4.19e-55 | |
5 | 6i9r:a | 83 | 108 | 0.6852 | 0.8916 | 0.6852 | 2.30e-46 | 7a5f:a3, 7a5g:a3, 7a5h:a, 7a5i:a3, 7a5j:a, 7a5k:a3, 3j9m:a, 6nu2:a, 6nu3:a, 7o9k:a, 7o9m:a, 7of0:a, 7of2:a, 7of3:a, 7of4:a, 7of5:a, 7of6:a, 7of7:a, 7oi6:a, 7oi7:a, 7oi8:a, 7oi9:a, 7oia:a, 7oib:a, 7oic:a, 7oid:a, 7oie:a, 5ool:a, 5oom:a, 7pd3:a, 7qh6:a, 7qh7:a, 8qu5:a |
6 | 5n6u:A | 811 | 92 | 0.1944 | 0.0259 | 0.2283 | 5.8 | 5n6u:B, 5n6u:C, 5n6u:D |
7 | 6xe6:A | 826 | 52 | 0.1574 | 0.0206 | 0.3269 | 6.8 | |
8 | 7rpk:A | 953 | 59 | 0.1667 | 0.0189 | 0.3051 | 7.5 | 7rph:A, 7rpi:A, 7rpj:A |
9 | 7e2i:D | 907 | 59 | 0.1667 | 0.0198 | 0.3051 | 7.8 | 7e2g:D, 7e2h:E |
10 | 2y9h:M | 193 | 68 | 0.1667 | 0.0933 | 0.2647 | 9.6 | 2y9h:K, 2y9h:O |