TYSAEIRRTTMGVPHIKAGNWGSAGYGFGYVQAQDNLCTMADSFLTYRGERSRHLGGSAQLVYNSTLGRPRNIDSDFFHR
HVISDEAVDRTMAAQPAKLLQMVEGFAAGYNRYVREAKAGGSAHAACRSEAWVQPITARDVWRRIYAANLAGGYSNFAEA
IANAQPP
The query sequence (length=167) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4yf9:D | 168 | 167 | 1.0000 | 0.9940 | 1.0000 | 4.50e-125 | 4yf9:A, 4yf9:G, 4yf9:J, 4yfa:A, 4yfa:D, 4yfa:G, 4yfa:J, 4yfb:D, 4yfb:A |
2 | 5ubk:A | 709 | 165 | 0.3533 | 0.0832 | 0.3576 | 1.11e-25 | 4k2f:B, 4k2g:B, 3l91:B, 4m1j:C, 3srb:A, 3srb:B, 3src:B, 4wks:C, 4wkt:C, 4wku:B, 4wkv:C, 2wyc:A, 2wyc:B |
3 | 1gm9:A | 207 | 117 | 0.1796 | 0.1449 | 0.2564 | 0.001 | 1fxh:A, 1fxv:A, 1k7d:A, 1kec:A |
4 | 7rep:A | 764 | 115 | 0.1916 | 0.0419 | 0.2783 | 0.002 | 4pel:B, 4pel:D, 4pel:F, 4pel:H, 4pem:B, 7reo:A |
5 | 7ea4:A | 762 | 103 | 0.1856 | 0.0407 | 0.3010 | 0.007 | 7ea4:B, 7eby:A, 7eby:B, 7eby:C, 7eby:D, 7eby:E, 7eby:F |
6 | 6nvy:A | 191 | 112 | 0.1737 | 0.1518 | 0.2589 | 0.035 | 6nvy:C |
7 | 1jvz:A | 152 | 116 | 0.1856 | 0.2039 | 0.2672 | 0.18 | |
8 | 5y2v:A | 304 | 54 | 0.1198 | 0.0658 | 0.3704 | 2.8 | 5y2v:B, 5y2v:C, 5y2v:D, 5y2w:A |
9 | 6can:A | 616 | 52 | 0.0778 | 0.0211 | 0.2500 | 2.9 | 6can:B, 5t88:A, 5t88:B |
10 | 4izc:B | 266 | 162 | 0.2515 | 0.1579 | 0.2593 | 6.2 | 4izc:A, 4izd:A, 4izd:B |
11 | 8fmw:AM | 122 | 22 | 0.0599 | 0.0820 | 0.4545 | 9.4 | 8fn2:M |