TYQEFTNIDQAKAWGNAQYKKYGLSKSEKEAIVSYTKSASEINGKLRQNKGVINGFPSNLIKQVELLDKSFNKMKTPENI
MLFRGDDPAYLGTEFQNTLLNSNGTINKTAFEKAKAKFLNKDRLEYGYISTSLMNVSQFAGRPIITKFKVAKGSKAGYID
PISAFAGQLEMLLPRHSTYHIDDMRLSSDGKQIIITATMMGT
The query sequence (length=202) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1gzf:B | 211 | 202 | 1.0000 | 0.9573 | 1.0000 | 1.29e-150 | 2a9k:B, 2c8a:A, 2c8a:B, 2c8a:C, 2c8a:D, 2c8c:A, 2c8c:D, 2c8c:B, 2c8c:C, 2c8f:E, 2c8h:A, 2c8h:B, 1gzf:A, 1gzf:C, 1gzf:D, 1uzi:A, 1uzi:B |
2 | 5bwm:B | 205 | 207 | 0.3861 | 0.3805 | 0.3768 | 1.08e-39 | 4xsh:B |
3 | 5dzq:O | 184 | 173 | 0.3564 | 0.3913 | 0.4162 | 6.66e-39 | 5dzq:A |
4 | 1ojz:A | 212 | 206 | 0.3663 | 0.3491 | 0.3592 | 3.38e-33 | |
5 | 1qs2:A | 401 | 198 | 0.2871 | 0.1446 | 0.2929 | 5.64e-18 | |
6 | 1qs2:A | 401 | 150 | 0.1832 | 0.0923 | 0.2467 | 0.020 | |
7 | 4fxq:A | 445 | 204 | 0.2772 | 0.1258 | 0.2745 | 3.25e-15 | 4fk7:A, 4fxq:B |
8 | 6x6x:A | 417 | 201 | 0.2624 | 0.1271 | 0.2637 | 7.82e-13 | 2wn6:A, 2wn7:A, 6x6r:A, 6x6r:B, 6x6v:A, 6x6v:B, 6x6v:C, 6x6v:D, 6x6x:B |
9 | 4h03:A | 414 | 203 | 0.2624 | 0.1280 | 0.2611 | 6.11e-11 | 3buz:A, 1giq:A, 1giq:B, 1gir:A, 4h0t:A, 4h0v:A, 4h0x:A, 4h0y:A |
10 | 5wtz:A | 420 | 202 | 0.2525 | 0.1214 | 0.2525 | 2.85e-09 | 5h04:A, 5wu0:A |
11 | 4uap:A | 150 | 75 | 0.1188 | 0.1600 | 0.3200 | 1.4 | 4uap:B |
12 | 4fxc:A | 98 | 30 | 0.0495 | 0.1020 | 0.3333 | 1.6 | |
13 | 5hma:A | 191 | 37 | 0.0644 | 0.0681 | 0.3514 | 5.0 | 5hm9:A |
14 | 2b3x:A | 888 | 63 | 0.0842 | 0.0191 | 0.2698 | 9.1 | 2b3y:A, 2b3y:B |