BioLiP

>protein
TYKLYIMTFQNAHFGSGTLDSSKLTFSADRIFSALVLEALKMGKLDAFLAEANQDKFTLTDAFPFQFGPFLPKPIGYPKD
VKEVRRQAKLSKKLQFLALENVDDYLNGELFENEEHAVIDTVTKNQPHKDDNLYQVATTRFSNDTSLYVIANESDLLNEL
MSSLQYSGLGGKRSSGFGRFELDIQNIPLELSDRLTKNHSDKVMSLTTALPVDADLEEAMEDGHYLLTKSSGFAFSHATN
ENYRKQDLYKFASGSTFSKTFEGQIVDVRPLDFPHAVLNYAKPLFFKL

The query sequence (length=288) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6ifn:B	297	296	1.0000	0.9697	0.9730	0.0	6ifk:B, 6ifr:B, 6ify:B, 6ifz:B, 6ig0:B, 6nud:I, 6nue:I
2	6ifl:G	273	288	0.9479	1.0000	0.9479	0.0	6ifu:G
3	9ash:B	297	291	0.4201	0.4074	0.4158	9.14e-48	9asi:B, 6xn5:B
4	6xn7:B	277	287	0.3993	0.4152	0.4007	4.60e-43	6xn3:B, 6xn4:B
5	7v01:H	297	308	0.3611	0.3502	0.3377	5.99e-42	8do6:B, 7uzw:H, 7uzx:H, 7uzy:H, 7uzz:H, 7v00:H, 7v02:H
6	8wfx:M	296	311	0.3889	0.3784	0.3601	8.21e-42
7	6mur:E	286	231	0.1840	0.1853	0.2294	0.001	6iqw:E, 6mus:E, 6mut:E, 6muu:E, 6o7e:E, 6o7h:E, 6o7i:E
8	2j68:A	680	57	0.0729	0.0309	0.3684	1.7	2w6d:A, 2w6d:B
9	5om9:A	396	20	0.0347	0.0253	0.5000	4.4	3fju:A, 6i6z:A, 6i6z:B, 5om9:B, 4uee:A, 4uee:B, 4uez:A, 4uez:B, 2v77:A, 2v77:B
10	6ifm:F	68	39	0.0486	0.2059	0.3590	5.3	6ifm:H, 6ifm:B, 6ifm:D
11	3bdv:A	191	62	0.0729	0.1099	0.3387	5.4

[Back]