TYGIRLRVWGDYACFTRPEMKVERVSYDVMPPSAARGILEAIHWKPAIRWIVDRIHVLRPIVFDNVRRNEVSSKIPKPNP
ATAMRDRKPLYFLVDDGSNRQQRAATLLRNVDYVIEAHFELTDKAGAEDNAGKHLDIFRRRARAGQSFQQPCLGCREFPA
SFELLEGDVPLSCYAGEKRDLGYMLLDIDFERDMTPLFFKAVMEDDVITPPSRTSPEVRA
The query sequence (length=220) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8dej:A | 220 | 220 | 1.0000 | 1.0000 | 1.0000 | 1.72e-165 | 8dex:A, 8dfa:A, 8dfo:A, 8dfs:A, 7kha:A |
2 | 8g9s:N | 205 | 216 | 0.4500 | 0.4829 | 0.4583 | 8.07e-58 | 8g9t:N, 8g9u:N, 8gaf:N, 8gam:N, 8gan:N |
3 | 6d24:A | 502 | 65 | 0.0818 | 0.0359 | 0.2769 | 2.2 | 5aq1:A, 5aq1:B, 5aq1:C, 6d24:B, 6d24:C, 6d24:D |
4 | 6l3w:A | 298 | 61 | 0.0909 | 0.0671 | 0.3279 | 4.4 | |
5 | 6gos:D | 396 | 69 | 0.0773 | 0.0429 | 0.2464 | 4.9 | 6grg:D |
6 | 6s8f:F | 2571 | 43 | 0.0545 | 0.0047 | 0.2791 | 5.7 | 7mq8:NR, 7mq9:NR, 7mqa:NR, 6s8f:H |