BioLiP

>protein
TYEILGQMDETFILVKDSEYLYFVDQHLLEERINYEKLKDENLACRISVKAGQKLSEEKIRELIKTWRNLENPHVCPHGR
PIYYKIPLREIYEKVGRNY

The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8h1e:A	102	99	1.0000	0.9706	1.0000	5.95e-70	8h1f:A, 8h1g:A, 5z41:A, 5z42:A
2	4e4w:B	213	66	0.1818	0.0845	0.2727	1.34e-04	4fmn:B, 4fmo:B
3	4e4w:B	213	57	0.2121	0.0986	0.3684	0.020	4fmn:B, 4fmo:B
4	3kdk:A	186	37	0.1616	0.0860	0.4324	1.48e-04	3kdk:B
5	3kdk:A	186	57	0.1919	0.1022	0.3333	5.10e-04	3kdk:B
6	6rmn:B	222	41	0.1818	0.0811	0.4390	0.004	6shx:B, 6sns:B, 6snv:B, 6snv:E
7	6rmn:B	222	38	0.1515	0.0676	0.3947	0.006	6shx:B, 6sns:B, 6snv:B, 6snv:E
8	8auv:F	216	51	0.1414	0.0648	0.2745	1.4	8b2l:F1, 7qix:F, 7qiz:v
9	3tvi:E	439	39	0.1111	0.0251	0.2821	2.0	3tvi:A, 3tvi:B, 3tvi:C, 3tvi:D, 3tvi:G, 3tvi:H, 3tvi:I, 3tvi:L
10	4emy:A	409	40	0.1414	0.0342	0.3500	2.8	4emy:B, 4emy:C, 4emy:D
11	1am9:C	82	52	0.1515	0.1829	0.2885	4.0	1am9:D, 1am9:A, 1am9:B
12	2x4d:A	270	54	0.1212	0.0444	0.2222	5.0
13	6r6u:A	458	39	0.1313	0.0284	0.3333	6.0	6r6u:B
14	5cmb:B	255	41	0.1616	0.0627	0.3902	6.4	5cmb:A, 5cmc:A, 5cmc:B, 4yki:A, 4yki:B, 4ykj:A, 4ykj:B, 4ykk:A, 4ykk:B, 4ykp:A, 4ykp:B
15	4dqd:A	361	34	0.1313	0.0360	0.3824	7.1	3sg0:A
16	8by5:A	198	67	0.2121	0.1061	0.3134	7.3
17	5h3z:B	1113	60	0.1717	0.0153	0.2833	9.0	5h40:A, 5h40:B, 5h41:A, 5h41:B, 5h42:A, 5h42:B

[Back]