TVTYTNRVADARLGTFSQLLLQWKGSIYKLLYSEFLIFISLYFAISLVYRLILSESQRLMFEKLALYCNSYAELIPVSFV
The query sequence (length=363) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
4rdq:A |
366 |
363 |
1.0000 |
0.9918 |
1.0000 |
0.0 |
6n23:A, 6n23:B, 6n23:C, 6n23:D, 6n23:E, 6n25:A, 6n25:B, 6n25:C, 6n25:D, 6n25:E, 6n27:A, 6n27:B, 6n27:C, 6n27:D, 6n27:E, 6n28:A, 6n28:B, 6n28:C, 6n28:D, 6n28:E, 4rdq:B, 4rdq:C, 4rdq:D, 4rdq:E, 5t5n:A, 5t5n:B, 5t5n:C, 5t5n:D, 5t5n:E |
2 |
9ctq:D |
376 |
363 |
0.7493 |
0.7234 |
0.7493 |
0.0 |
9ctq:E, 9ctq:C, 9ctq:B, 9ctq:A, 9ctr:B, 9ctr:A, 9ctr:C, 9ctr:E, 9ctr:D, 9cts:B, 9cts:E, 9cts:D, 9cts:A, 9cts:C, 9ctt:D, 9ctt:B, 9ctt:E, 9ctt:A, 9ctt:C, 8d1i:D, 8d1i:B, 8d1i:E, 8d1i:A, 8d1i:C, 8d1j:A, 8d1j:C, 8d1j:B, 8d1j:D, 8d1j:E, 8d1k:D, 8d1k:B, 8d1k:A, 8d1k:E, 8d1k:C, 8d1l:B, 8d1l:C, 8d1l:A, 8d1l:D, 8d1l:E, 8d1o:E, 8d1o:A, 8d1o:B, 8d1o:C, 8d1o:D |
3 |
8d1e:D |
376 |
364 |
0.6804 |
0.6569 |
0.6786 |
0.0 |
8d1e:E, 8d1e:C, 8d1e:A, 8d1e:B, 8d1f:C, 8d1f:E, 8d1f:A, 8d1f:D, 8d1f:B, 8d1g:A, 8d1g:B, 8d1g:E, 8d1g:C, 8d1g:D, 8d1h:E, 8d1h:B, 8d1h:A, 8d1h:C, 8d1h:D, 8d1n:E, 8d1n:D, 8d1n:A, 8d1n:C, 8d1n:B, 8ecy:E, 8ecy:C, 8ecy:G, 8ecy:K, 8ecy:N, 6vx6:E, 6vx6:A, 6vx6:B, 6vx6:C, 6vx6:D, 6vx7:C, 6vx7:A, 6vx7:B, 6vx7:E, 6vx7:D |
4 |
6ly5:L |
196 |
44 |
0.0441 |
0.0816 |
0.3636 |
1.3 |
6l4t:11, 6l4u:11 |
5 |
8c45:A |
1218 |
70 |
0.0523 |
0.0156 |
0.2714 |
4.0 |
8c45:B, 8q56:A |
6 |
8jqe:A |
296 |
55 |
0.0441 |
0.0541 |
0.2909 |
7.7 |
8jqe:B |
7 |
7w54:B |
518 |
25 |
0.0303 |
0.0212 |
0.4400 |
8.2 |
7w54:A |
8 |
5eud:A |
454 |
96 |
0.0689 |
0.0551 |
0.2604 |
9.8 |
5eud:B, 5eue:A, 5eue:B, 3mad:A, 3mad:B, 3mau:A, 3mau:B, 3mau:C, 3mau:D, 3mbb:A, 3mbb:B |