BioLiP

>protein
TVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFR
SAEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGA
DIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVL
TILHQ

The query sequence (length=245) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4guh:B	265	249	1.0000	0.9245	0.9839	1.55e-178	4gug:A, 4gug:B, 4guh:A, 4gui:A, 4gui:B, 4guj:A, 4guj:B, 4iuo:A, 4iuo:B, 3m7w:A, 3m7w:B, 3m7w:C, 3m7w:D, 3m7w:E, 3m7w:F, 3nnt:A, 3nnt:B
2	8b2b:AAA	252	249	0.7633	0.7421	0.7510	1.13e-137	8b2b:BBB, 8b2c:AAA, 4clm:B, 4cno:A, 4cno:B, 4cno:C, 4cno:D, 4cnp:A, 4cnp:B, 6h5c:A, 6h5c:B, 6h5d:A, 6h5d:B, 6h5g:A, 6h5j:A, 1l9w:A, 1l9w:B, 1l9w:C, 1l9w:D, 1qfe:A, 1qfe:B, 6sfe:A, 6sfe:B, 6sfg:A, 4uio:A
3	4h3d:B	254	248	0.5633	0.5433	0.5565	1.54e-96	4h3d:A, 4h3d:C, 4h3d:D, 3js3:A, 3js3:B, 3js3:C, 3js3:D
4	8b2a:BBB	238	219	0.3020	0.3109	0.3379	2.55e-32	8b2a:AAA, 1sfj:A, 1sfj:B, 6sfh:A, 6sfh:B
5	2o7q:A	501	232	0.2898	0.1417	0.3060	5.13e-18	6bmb:A, 6bmq:A, 2gpt:A, 2o7s:A
6	6hqv:A	1555	185	0.1755	0.0277	0.2324	4.99e-05	6hqv:B
7	8dek:B	441	83	0.0980	0.0544	0.2892	1.0	8dek:A, 8df2:A, 8df2:B, 8df2:C, 8df2:D
8	8emt:B	1221	49	0.0653	0.0131	0.3265	2.4
9	3t4k:A	268	53	0.0653	0.0597	0.3019	3.4	3t4j:A, 3t4j:B, 3t4k:B, 3t4l:A, 3t4l:B, 3t4o:A, 3t4o:B, 3t4q:A, 3t4q:B, 3t4s:A, 3t4s:B, 3t4t:A, 3t4t:B
10	2vsi:B	227	99	0.1061	0.1145	0.2626	3.8	2vsi:A
11	1xtp:A	246	50	0.0694	0.0691	0.3400	7.9
12	6tg9:G	148	46	0.0531	0.0878	0.2826	8.0	6tg9:C, 6tga:G, 6tga:C
13	5dqr:C	421	97	0.1102	0.0641	0.2784	8.7	5dqr:A, 5dqr:B, 5dqr:D, 5dqr:E, 5dqr:F
14	4luj:A	214	142	0.1551	0.1776	0.2676	9.1	4luj:B

[Back]