TVREARAEAFVTMRSETLAMIIDGRHHKGDVFATARIAGIQAAKRTWDLIPLCHPLMLSKVEVNLQAEPEHNRVRIETLC
RLTGKTGVEMEALTAASVAALTIYDMCKAVQKDMVIGPVRLL
The query sequence (length=122) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4pyd:C | 154 | 122 | 1.0000 | 0.7922 | 1.0000 | 8.37e-88 | 4pya:A, 4pyd:A, 4pyd:B, 4pyd:E, 4pyd:D, 4pyd:F |
2 | 3jqj:B | 149 | 122 | 0.5410 | 0.4430 | 0.5410 | 1.79e-36 | 3jqj:A, 3jqj:C, 3jqj:D, 3jqj:E, 3jqj:F, 3jqj:G, 3jqj:H, 3jqj:K, 3jqj:I, 3jqj:J, 3jqj:L, 3jqk:A, 3jqm:A, 3jqm:B, 3jqm:E, 3jqm:C, 3jqm:G, 3jqm:D, 3jqm:F, 3jqm:H, 3jqm:I |
3 | 8y6o:X | 131 | 62 | 0.1393 | 0.1298 | 0.2742 | 2.6 | |
4 | 5cfc:B | 232 | 36 | 0.0820 | 0.0431 | 0.2778 | 2.6 | 5cfd:B |