BioLiP

>protein
TVFYTSIDIGSRYIKGLVLGKWEALAFSSVKSRGLDEGEIKDAIAFKESVNTLLKELEEQLQKSLRSDFVISFSSVSFER
EDTVIERDFGEEKRSITLDILSEMQSEALEKLKENGKTPLHIFSKRYLLDDERIVFNPLDMKASKIAIEYTSIVVPLKVY
EMFYNFLQDTVKSPFQLKSSLVSTAEGVLTTPEKDRGVVVVNLGYNFTGLIAYKNGVPIKISYVPVGMKHVIKDVSAVLD
TSFEESERLIITHGNAVYNDLKEEEIQYRGLDGNTIKTTTAKKLSVIIHARLREIMSKSKKFFREVEAKIPGGVVLTGGG
AKIPRINELATEVFKSPVRTGCYANSDRPSIINADEVANDPSFAAAFGNVFA

The query sequence (length=372) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4a2b:A	386	384	1.0000	0.9637	0.9688	0.0	4a2a:A, 4a2a:B, 1e4g:T
2	3wt0:D	378	355	0.2204	0.2169	0.2310	2.09e-17	3wqt:A, 3wqt:C, 3wqt:D, 3wqu:A, 3wqu:B, 3wqu:C, 3wqu:D, 3wt0:A, 3wt0:B, 3wt0:C
3	7q6g:A	388	389	0.2204	0.2113	0.2108	1.24e-16	7q6d:A
4	7q6i:B	383	354	0.2097	0.2037	0.2203	1.49e-15	7q6f:A, 7q6f:B, 7q6i:A, 7q6i:C, 7q6i:E, 7q6i:F, 7q6i:G, 7q6i:H, 7q6i:I, 7q6i:J, 7q6i:K, 7q6i:L, 7q6i:M, 7q6i:N, 7q6i:O, 7q6i:P
5	3wqt:B	334	345	0.2124	0.2365	0.2290	2.64e-15
6	7q6i:D	362	353	0.2043	0.2099	0.2153	7.57e-13
7	1n2z:A	245	34	0.0376	0.0571	0.4118	0.98	5m29:A, 5m29:B, 5m2q:A, 5m2q:B, 5m34:A, 5m34:B, 5m3b:A, 5m3b:B, 1n2z:B, 1n4a:A, 1n4a:B
8	4zm1:C	232	126	0.0941	0.1509	0.2778	1.0
9	3jc9:Ma	355	175	0.1156	0.1211	0.2457	1.4	3jc9:Mb, 3jc9:Mc, 3jc9:Md, 3jc9:Me, 3jc9:Mf, 3jc9:Mg, 3jc9:Mh, 3jc9:Mi, 3jc9:Mj, 3jc9:Mk, 3jc9:Ml
10	8fkt:SY	378	90	0.0645	0.0635	0.2667	2.9	8fku:SY, 8fkv:SY, 8fkw:SY, 8fkx:SY, 8fky:SY
11	4gt2:A	371	49	0.0430	0.0431	0.3265	3.6	4gt2:B, 4gt2:E, 4gt2:G, 6gzw:A, 6gzw:B, 5map:A, 5map:B, 5mjh:A, 5mjh:B
12	7kh2:D	415	64	0.0591	0.0530	0.3438	5.6	7kh2:A, 7kh2:B, 7kh2:C
13	7anv:A	467	44	0.0349	0.0278	0.2955	8.9

[Back]