TVFEELKRYVGWGDGDERALRSLHGAAAPHFPRLAEEFYDRILGHEGARTALVGGESQVGHLKVTMIAWLDELLGGPWDE
AYWDRRYRIGRVHVRIGLPQHYMFGAMNVHRTGLARLAYERFHGDPPELERVRNALGKVLDLELAVMLHTYR
The query sequence (length=152) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5ohe:F | 155 | 152 | 1.0000 | 0.9806 | 1.0000 | 7.94e-109 | 5ohe:A, 5ohe:B, 5ohe:C, 5ohe:D, 5ohe:E, 5ohe:G, 5ohe:H, 5ohf:A, 5ohf:B, 5ohf:C, 5ohf:D, 5ohf:E, 5ohf:F, 5ohf:G, 5ohf:H, 6otd:A |
2 | 2w31:A | 152 | 152 | 0.3618 | 0.3618 | 0.3618 | 9.96e-20 | 2w31:B |
3 | 8h17:A | 157 | 137 | 0.2829 | 0.2739 | 0.3139 | 2.45e-12 | |
4 | 1or4:A | 169 | 142 | 0.2697 | 0.2426 | 0.2887 | 7.85e-12 | 1or4:B, 1or6:A, 1or6:B |
5 | 4zvb:A | 150 | 75 | 0.1447 | 0.1467 | 0.2933 | 0.94 | 4zva:A, 4zva:B, 4zvb:B, 4zvb:C, 4zvb:D |
6 | 6m9a:C | 157 | 72 | 0.1316 | 0.1274 | 0.2778 | 1.2 | 6i2z:A, 6i2z:B, 6m9a:A, 6m9a:B, 4uiq:A, 4uiq:B |
7 | 6nrq:B | 104 | 32 | 0.0658 | 0.0962 | 0.3125 | 1.4 | |
8 | 8zfk:D | 412 | 54 | 0.0855 | 0.0316 | 0.2407 | 2.3 | 8zfk:E, 8zfk:A, 8zfk:B, 8zfk:C |
9 | 8k7x:A | 673 | 81 | 0.1447 | 0.0327 | 0.2716 | 6.0 | 8k7y:A, 8k7y:E |
10 | 1rrv:A | 401 | 24 | 0.0724 | 0.0274 | 0.4583 | 6.7 | 1rrv:B |
11 | 7ui4:A | 413 | 32 | 0.0855 | 0.0315 | 0.4062 | 7.1 |