BioLiP

>protein
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQ
GRVRKAERWGPATLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW

The query sequence (length=158) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5etl:D	160	158	0.9937	0.9812	0.9937	1.15e-115	6an4:A, 6an6:A, 6an6:B, 1dy3:A, 1eqm:A, 5etk:A, 5etl:A, 5etl:B, 5etl:C, 5etm:A, 5etn:A, 5eto:A, 5etp:A, 1ex8:A, 4f7v:A, 1f9h:A, 1g4c:B, 3hd1:A, 3hd2:A, 1hq2:A, 3hsd:A, 3hsd:B, 3hsg:A, 3ht0:A, 3ilj:A, 3ilo:A, 3ip0:A, 7kdo:A, 7kdr:A, 3kuh:A, 4m5g:A, 4m5h:A, 4m5i:A, 4m5j:A, 4m5k:A, 4m5l:A, 4m5m:A, 4m5n:A, 4m5n:B, 1q0n:A, 1rao:A, 1rb0:A, 1rtz:A, 1ru1:A, 1ru1:B, 1ru2:A, 8sif:A, 1tmj:A, 1tmm:A, 1tmm:B, 3ud5:A, 3ude:A, 3udv:A
2	2qx0:A	159	155	0.6139	0.6101	0.6258	8.82e-69	2qx0:B
3	1cbk:A	160	155	0.5506	0.5437	0.5613	5.07e-62	1cbk:B
4	8sk1:A	162	135	0.3608	0.3519	0.4222	1.32e-31	8sk1:B
5	3qbc:B	161	140	0.3544	0.3478	0.4000	2.57e-31	4ad6:A, 4ad6:B, 4crj:A, 4cwb:A, 4cyu:A, 4cyu:B, 4cyu:C, 4cyu:D, 5etq:A, 5etq:B, 5etr:B, 5etr:A, 5ets:B, 5ets:A, 5ett:B, 5ett:A, 5etv:A, 3qbc:A
6	8sl9:A	422	134	0.2975	0.1114	0.3507	4.06e-21	4pzv:A
7	3mco:A	397	132	0.2911	0.1159	0.3485	6.67e-19	3mcn:B, 3mco:B
8	2bmb:A	513	142	0.2848	0.0877	0.3169	1.99e-15
9	3mcm:A	368	129	0.2595	0.1114	0.3178	5.29e-13	3mcn:A
10	7weg:B	96	24	0.0759	0.1250	0.5000	0.60	7weg:A
11	8ebu:A	604	89	0.1582	0.0414	0.2809	1.1	8ebt:A, 8ebx:A, 8eby:A
12	7lbm:W	574	89	0.1582	0.0436	0.2809	1.1
13	7ena:6	652	89	0.1582	0.0383	0.2809	1.1	7ad8:A, 8bvw:0, 8ebs:A, 8ebv:A, 8ebw:A, 7egb:6, 7egc:6, 7enc:6, 8gxq:HH, 8gxs:HH, 5ivw:V, 5iy6:V, 5iy7:V, 5iy8:V, 5iy9:V, 7nvr:7, 7nvv:7, 7nvw:7, 7nvx:7, 7nvy:7, 7nvz:7, 7nw0:7, 6o9l:7, 6ro4:A, 8wak:6, 8wal:6, 8wan:6, 8wao:6, 8wap:6, 8waq:6, 8war:6, 8was:6
14	8jfk:B	1033	34	0.0949	0.0145	0.4412	1.2	8jfk:N, 8jfk:J, 8jfk:F, 8jfl:B, 8jfl:N, 8jfl:F, 8jfl:J, 8xya:B
15	7aor:ae	574	35	0.0823	0.0226	0.3714	1.2
16	5xwd:A	611	87	0.1709	0.0442	0.3103	1.3
17	7bqo:A	451	147	0.2215	0.0776	0.2381	2.6
18	7pc5:A	405	24	0.0759	0.0296	0.5000	2.7
19	7sjr:B	802	37	0.0886	0.0175	0.3784	4.2
20	6vqw:A	80	58	0.1013	0.2000	0.2759	7.8
21	5w5j:B	257	113	0.2025	0.1245	0.2832	7.8	5ar8:A, 5w5j:A

[Back]