TVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVES
TGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKTAKTNT
NEFLIDVCFSVQAVIPSRTVNRKSTDSPVEC
The query sequence (length=191) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3ela:T | 191 | 191 | 1.0000 | 1.0000 | 1.0000 | 3.77e-141 | |
2 | 3dgc:R | 202 | 152 | 0.2304 | 0.2178 | 0.2895 | 2.25e-07 | |
3 | 6weo:7 | 201 | 153 | 0.2199 | 0.2090 | 0.2745 | 9.77e-05 | 6weo:F, 6weo:M, 6weo:V |
4 | 8gzh:C | 1052 | 64 | 0.0995 | 0.0181 | 0.2969 | 2.0 | 8gzg:C |
5 | 7jve:B | 251 | 65 | 0.0942 | 0.0717 | 0.2769 | 2.4 | 7jve:C, 7jve:F |
6 | 2z1a:A | 507 | 72 | 0.1047 | 0.0394 | 0.2778 | 2.5 | |
7 | 8xr6:Q | 143 | 99 | 0.1518 | 0.2028 | 0.2929 | 5.4 | 8xr6:q |
8 | 4dch:A | 434 | 76 | 0.0942 | 0.0415 | 0.2368 | 10.0 | 4ise:A, 4isf:A, 4isg:A, 5v4w:A, 5v4x:A |