TTNADRRKAATMRERRRLSKVNEAFETLKRSTSSNPNQRLPKVEILRNAIRYIEGLQALLRD
The query sequence (length=62) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1mdy:A | 68 | 62 | 1.0000 | 0.9118 | 1.0000 | 2.59e-39 | 1mdy:B, 1mdy:C, 1mdy:D |
2 | 7z5i:A | 56 | 53 | 0.7581 | 0.8393 | 0.8868 | 4.07e-29 | 7z5i:B, 7z5k:A, 7z5k:B |
3 | 8osb:B | 66 | 56 | 0.3387 | 0.3182 | 0.3750 | 3.50e-07 | |
4 | 2ypa:A | 67 | 62 | 0.4194 | 0.3881 | 0.4194 | 4.15e-06 | 2ypb:A |
5 | 2ql2:B | 59 | 59 | 0.3548 | 0.3729 | 0.3729 | 9.78e-05 | 2ql2:D |
6 | 1hlo:A | 80 | 55 | 0.2419 | 0.1875 | 0.2727 | 0.004 | |
7 | 2ypb:B | 74 | 60 | 0.3387 | 0.2838 | 0.3500 | 0.005 | 2ql2:A, 2ql2:C, 2ypa:B |
8 | 5eyo:C | 88 | 53 | 0.2419 | 0.1705 | 0.2830 | 0.015 | 1an2:A, 5eyo:A, 1hlo:B, 1nkp:B, 1nkp:E, 1nlw:B, 1nlw:E |
9 | 6od3:A | 62 | 59 | 0.3387 | 0.3387 | 0.3559 | 0.062 | 6od3:B, 6od3:H, 6od3:E, 6od3:F, 6od4:A, 6od4:B, 6od5:A, 6od5:B, 6od5:C, 6od5:D, 8osb:A |
10 | 7b1g:A | 691 | 48 | 0.2903 | 0.0260 | 0.3750 | 0.30 | 7b05:A, 7b05:D, 7b05:B, 7b05:C, 7b0s:A, 7b0s:D, 7b0s:B, 7b0s:C, 7b16:A, 7b16:B, 7b16:C, 7b16:D, 7b1g:C, 7b1g:B, 7b1g:D, 6g1k:A, 6g1k:B, 6g1k:D, 6g1k:C |
11 | 8iwo:A | 956 | 50 | 0.2258 | 0.0146 | 0.2800 | 0.70 | 8iwo:B, 8j2m:A, 8j2m:B |
12 | 5i50:B | 96 | 54 | 0.2742 | 0.1771 | 0.3148 | 1.1 | 5i50:A, 1nkp:A, 1nkp:D |
13 | 8ix9:C | 314 | 17 | 0.1290 | 0.0255 | 0.4706 | 3.7 | 8ix9:B, 8ix9:A, 8ixh:A, 8ixh:B, 8ixh:C, 8ixm:A, 8ixm:B |
14 | 2bff:A | 392 | 35 | 0.2258 | 0.0357 | 0.4000 | 3.7 | 2beu:A, 2bev:A, 2bew:A, 2bfd:A, 2bfe:A, 1dtw:A, 2j9f:A, 2j9f:C, 1ols:A, 1olx:A, 1u5b:A, 1wci:A, 1x7z:A |
15 | 1v1m:A | 372 | 35 | 0.2258 | 0.0376 | 0.4000 | 4.0 | 2bfb:A, 2bfc:A, 1olu:A, 1v11:A, 1v16:A, 1x7w:A, 1x7x:A, 1x7y:A, 1x80:A |
16 | 3tgw:B | 441 | 31 | 0.1613 | 0.0227 | 0.3226 | 4.4 | 3b2q:A, 3b2q:B, 3dsr:A, 3dsr:B, 3eiu:A, 3eiu:B, 3tiv:B |
17 | 2koh:A | 111 | 23 | 0.2097 | 0.1171 | 0.5652 | 5.9 | 9imp:A, 9imp:B, 9imp:C, 9imp:D, 9imp:E, 9imp:F, 6jue:L, 2k20:A |
18 | 1am9:C | 82 | 54 | 0.2903 | 0.2195 | 0.3333 | 6.3 | 1am9:D, 1am9:A, 1am9:B |