TTLTVDLSTTYQRIDGFGTSEAFQRAVQMSRLPEEGQRRALDVLFSTTNGAGLSILRNGIGSSPDMSSDHMVSIAPKSPG
The query sequence (length=441) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
8cbc:A |
455 |
448 |
0.9977 |
0.9670 |
0.9821 |
0.0 |
8c48:A, 8c48:B, 8cbc:B, 7o0e:A, 7o0e:G, 8p67:A, 8p67:B |
2 |
6krn:A |
456 |
452 |
0.4535 |
0.4386 |
0.4425 |
4.15e-124 |
|
3 |
6m5z:A |
433 |
443 |
0.4286 |
0.4365 |
0.4266 |
3.34e-109 |
6m5z:B |
4 |
8idp:A |
446 |
450 |
0.3605 |
0.3565 |
0.3533 |
2.25e-75 |
8idp:C, 8idp:B, 8idp:D, 8idq:A, 8idq:B, 8idq:C, 8idq:D |
5 |
7n6o:A |
433 |
432 |
0.3152 |
0.3210 |
0.3218 |
5.57e-56 |
7n6o:B |
6 |
2y24:A |
383 |
455 |
0.2517 |
0.2898 |
0.2440 |
6.54e-14 |
|
7 |
4qaw:A |
537 |
368 |
0.2041 |
0.1676 |
0.2446 |
3.79e-10 |
4qaw:B, 4qaw:C, 4qaw:D, 4qaw:E, 4qaw:F, 4qaw:G, 4qaw:H, 4qb1:A, 4qb2:A, 4qb6:A |
8 |
2wnw:B |
445 |
290 |
0.1519 |
0.1506 |
0.2310 |
2.94e-08 |
2wnw:A |
9 |
4uqa:A |
391 |
194 |
0.1247 |
0.1407 |
0.2835 |
1.32e-06 |
5a6l:A, 5a6m:A, 4ckq:A, 4uqc:A |
10 |
9fa6:A |
501 |
225 |
0.1293 |
0.1138 |
0.2533 |
3.11e-06 |
8awk:AAA, 8awr:AAA, 8ax3:A, 8ax3:B, 9f9z:A, 9fa3:A, 9fad:A, 9fal:A, 9fay:A, 9faz:A, 9fb2:A, 9fdi:A, 3gxf:B, 3gxf:D, 5lvx:C, 5lvx:B, 5lvx:A, 5lvx:D, 6moz:A, 2nsx:A, 2nsx:B, 2nsx:C, 2nsx:D, 2nt0:A, 2nt0:B, 2nt0:C, 2nt0:D, 7nwv:AAA, 7nwv:BBB, 8p3e:B, 8p41:A, 8p41:B, 6q1n:A, 6q1n:B, 6q1p:A, 6q1p:B, 6q6k:A, 6q6k:B, 6q6l:A, 6q6l:B, 6q6n:A, 6q6n:B, 3rik:B, 3rik:D, 3ril:A, 3ril:B, 3ril:C, 3ril:D, 6t13:B, 6t13:C, 6t13:A, 6t13:D, 6tjq:BBB, 6tn1:AAA, 2v3d:A, 2v3d:B, 2v3e:A, 2v3e:B, 2vt0:A, 2vt0:B, 2wcg:A, 2wcg:B, 2xwd:A, 2xwd:B, 2xwe:A, 2xwe:B, 1y7v:A, 1y7v:B, 6ytp:AAA, 6ytp:BBB, 6ytr:AAA, 6ytr:BBB, 6yut:AAA, 6yut:BBB, 6yv3:AAA, 6yv3:BBB, 6z39:AAA, 6z39:BBB, 6z3i:BBB |
11 |
9fa6:A |
501 |
70 |
0.0476 |
0.0419 |
0.3000 |
0.007 |
8awk:AAA, 8awr:AAA, 8ax3:A, 8ax3:B, 9f9z:A, 9fa3:A, 9fad:A, 9fal:A, 9fay:A, 9faz:A, 9fb2:A, 9fdi:A, 3gxf:B, 3gxf:D, 5lvx:C, 5lvx:B, 5lvx:A, 5lvx:D, 6moz:A, 2nsx:A, 2nsx:B, 2nsx:C, 2nsx:D, 2nt0:A, 2nt0:B, 2nt0:C, 2nt0:D, 7nwv:AAA, 7nwv:BBB, 8p3e:B, 8p41:A, 8p41:B, 6q1n:A, 6q1n:B, 6q1p:A, 6q1p:B, 6q6k:A, 6q6k:B, 6q6l:A, 6q6l:B, 6q6n:A, 6q6n:B, 3rik:B, 3rik:D, 3ril:A, 3ril:B, 3ril:C, 3ril:D, 6t13:B, 6t13:C, 6t13:A, 6t13:D, 6tjq:BBB, 6tn1:AAA, 2v3d:A, 2v3d:B, 2v3e:A, 2v3e:B, 2vt0:A, 2vt0:B, 2wcg:A, 2wcg:B, 2xwd:A, 2xwd:B, 2xwe:A, 2xwe:B, 1y7v:A, 1y7v:B, 6ytp:AAA, 6ytp:BBB, 6ytr:AAA, 6ytr:BBB, 6yut:AAA, 6yut:BBB, 6yv3:AAA, 6yv3:BBB, 6z39:AAA, 6z39:BBB, 6z3i:BBB |
12 |
3kl0:A |
397 |
367 |
0.1791 |
0.1990 |
0.2153 |
2.10e-05 |
3kl3:A, 3kl3:B, 3kl5:A, 3kl5:B, 3kl5:C |
13 |
5ngl:B |
454 |
218 |
0.1111 |
0.1079 |
0.2248 |
5.14e-04 |
5ngl:A, 5ngl:C |
14 |
5ngl:B |
454 |
59 |
0.0408 |
0.0396 |
0.3051 |
0.017 |
5ngl:A, 5ngl:C |
15 |
6yyi:B |
502 |
124 |
0.0726 |
0.0637 |
0.2581 |
3.2 |
|
16 |
3iar:A |
360 |
50 |
0.0454 |
0.0556 |
0.4000 |
3.4 |
2bgn:E, 2bgn:F, 2bgn:G, 2bgn:H, 2e1w:A, 1krm:A, 1ndv:A, 1ndw:A, 1ndy:A, 1ndz:A, 1o5r:A, 1qxl:A, 7rtg:A, 7rtg:B, 1uml:A, 1v79:A, 1v7a:A, 1vfl:A, 1w1i:E, 1w1i:F, 1w1i:G, 1w1i:H, 1wxy:A, 1wxz:A, 2z7g:A |
17 |
8ayz:A |
278 |
92 |
0.0544 |
0.0863 |
0.2609 |
9.5 |
1eah:1, 3epf:1 |