TTHFTVADRWGNVVSYTTTIEQLFGTGIMVPDYGVILNNELTDFDAIPGGANEVQPNKRPLSSMTPTILFKDDKPVLTVG
The query sequence (length=183) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
3a75:D |
184 |
183 |
1.0000 |
0.9946 |
1.0000 |
7.09e-135 |
3a75:B, 3whs:B |
2 |
4otu:B |
182 |
182 |
0.7923 |
0.7967 |
0.7967 |
2.90e-108 |
5xlu:B, 5y8x:B, 5y9b:B |
3 |
5bpk:C |
188 |
170 |
0.4098 |
0.3989 |
0.4412 |
1.23e-39 |
5bpk:D, 3fnm:B, 3fnm:D, 2qm6:B, 2qm6:D, 2qmc:B, 2qmc:D |
4 |
5b5t:B |
190 |
181 |
0.4044 |
0.3895 |
0.4088 |
2.89e-37 |
5b5t:D, 2dbw:B, 2dbw:D, 2dbx:B, 2dbx:D, 2dg5:B, 2dg5:D, 2e0x:B, 2e0x:D, 2z8i:B, 2z8i:D, 2z8j:B, 2z8j:D, 2z8k:B, 2z8k:D |
5 |
7d9w:B |
194 |
197 |
0.3443 |
0.3247 |
0.3198 |
5.12e-26 |
7d9e:B, 7d9w:D, 7d9x:B, 7d9x:D, 5zjg:B, 5zjg:D |
6 |
4gdx:B |
189 |
190 |
0.3388 |
0.3280 |
0.3263 |
6.37e-25 |
4gg2:B, 7la5:B, 7lbc:B, 7ld9:B, 5v4q:B, 6xpb:B, 6xpc:B, 4zbk:B, 4zc6:B, 4zcg:B |
7 |
3ga9:S |
167 |
178 |
0.3279 |
0.3593 |
0.3371 |
6.49e-17 |
3g9k:S |
8 |
2jah:C |
246 |
40 |
0.0820 |
0.0610 |
0.3750 |
2.7 |
2jah:A, 2jah:B, 2jah:D, 2jap:A, 2jap:B, 2jap:C, 2jap:D |
9 |
5ndx:A |
606 |
65 |
0.0929 |
0.0281 |
0.2615 |
4.3 |
|
10 |
7egv:A |
590 |
34 |
0.0656 |
0.0203 |
0.3529 |
8.5 |
7egv:B, 7ehe:A, 7ehe:B |
11 |
4ctf:AZ |
246 |
56 |
0.0874 |
0.0650 |
0.2857 |
9.1 |
4ctf:A0, 4ctf:A1, 4ctf:A2, 4ctf:A3, 4ctf:A4, 4ctf:A5, 4ctf:A6, 4ctf:A7, 4ctf:A8, 4ctf:AA, 4ctf:AB, 4ctf:AC, 4ctf:AD, 4ctf:AE, 4ctf:AF, 4ctf:AG, 4ctf:AH, 4ctf:AI, 4ctf:AJ, 4ctf:AK, 4ctf:AL, 4ctf:AM, 4ctf:AN, 4ctf:AO, 4ctf:AP, 4ctf:AQ, 4ctf:AR, 4ctf:Ao, 4ctf:AS, 4ctf:AT, 4ctf:AU, 4ctf:AV, 4ctf:AW, 4ctf:AX, 4ctf:AY, 4ctf:A9, 4ctf:An, 4ctf:Aa, 4ctf:Ab, 4ctf:Ac, 4ctf:Ad, 4ctf:Ae, 4ctf:Af, 4ctf:Ag, 4ctf:Ah, 4ctf:Ai, 4ctf:Aj, 4ctf:Ak, 4ctf:Al, 4ctf:Am, 4ctf:BA, 4ctf:BB, 4ctf:BC, 4ctf:BD, 4ctf:BE, 4ctf:BF, 4ctf:BG, 4ctf:BH, 4ctf:BI, 2wff:1, 2ws9:1, 2xbo:1 |
12 |
3iwk:H |
497 |
40 |
0.0765 |
0.0282 |
0.3500 |
9.1 |
3iwk:A, 3iwk:B, 3iwk:C, 3iwk:D, 3iwk:E, 3iwk:F, 3iwk:G, 3iwk:I, 3iwk:J, 3iwk:K, 3iwk:L |