TTEPVKDHRRRRAAAIISHVEPETFEDENDQQLLPNMNATWVDQRGAWIIHVVIIILLKLFYNLFPGVTTEWSWTLTNMT
YVIGSYVMFHLIKGTPFDFNGGAYDNLTMWEQIDDETLYTPSRKFLISVPIALFLVSTHYAHYDLKLFSWNCFLTTFGAV
VPKLPVTHRLRISIPGITGRAQIS
The query sequence (length=184) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8c80:A | 184 | 184 | 1.0000 | 1.0000 | 1.0000 | 3.37e-138 | 8c81:A, 8c82:A, 8c82:E |
2 | 8iaj:D | 182 | 183 | 0.7500 | 0.7582 | 0.7541 | 1.13e-103 | 8iaj:H, 8iam:D, 8iam:H, 8qof:A, 8qof:E, 8qog:A |
3 | 7yiu:D | 153 | 138 | 0.2826 | 0.3399 | 0.3768 | 2.44e-23 | 7cqi:A, 7cqk:A, 6m4o:A, 7yiy:D |
4 | 7yjk:D | 156 | 144 | 0.2717 | 0.3205 | 0.3472 | 2.12e-20 | 7yjk:H, 7yjm:D, 7yjn:D, 7yjo:D |
5 | 4i8v:A | 477 | 72 | 0.1196 | 0.0461 | 0.3056 | 0.56 | 6dwm:A, 6dwm:B, 6dwm:C, 6dwm:D, 6dwn:A, 6dwn:B, 6dwn:C, 4i8v:B, 4i8v:C, 4i8v:D, 6o5y:A, 6o5y:B, 6o5y:C, 6o5y:D, 6udl:A, 6udl:B, 6udl:C, 6udl:D, 6udm:A, 6udm:B, 6udm:C, 6udm:D |
6 | 5xy3:H | 192 | 96 | 0.1359 | 0.1302 | 0.2604 | 1.7 | |
7 | 4are:A | 678 | 25 | 0.0761 | 0.0206 | 0.5600 | 6.0 | 2y50:A, 2y6i:A, 7z5u:A, 7zbv:A |
8 | 6ici:A | 585 | 71 | 0.0870 | 0.0274 | 0.2254 | 7.7 | |
9 | 4hg6:A | 747 | 45 | 0.0761 | 0.0187 | 0.3111 | 9.6 | 5eiy:A, 5ej1:A, 5ejz:A, 4p00:A, 4p02:A |