TTAQHPTDEDLLARVLVPYKDHCKYLRSAVVTEGRAVARCEFAIPESCYIDDTGHLNSVEVNICYNQMMYYLVAKSVKEG
LLAGFESWTLDDFWKHQLPDILIARFASNFRRPVNPRAFSGEMEFQSVTRRAPAGPFLHAETAYRYWDADSGRCDGEAVL
AFVNI
The query sequence (length=165) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5wsy:B | 165 | 165 | 1.0000 | 1.0000 | 1.0000 | 3.86e-125 | 5wsy:A |
2 | 2pz8:A | 280 | 63 | 0.1091 | 0.0643 | 0.2857 | 0.43 | 2pz8:B, 2pza:A, 2pza:B |
3 | 6c8q:A | 268 | 79 | 0.1333 | 0.0821 | 0.2785 | 1.0 | 6c8q:B, 6c8q:C, 6c8q:G, 6c8q:D, 6c8q:F, 6c8q:E, 6c8q:H |
4 | 8bmw:J | 270 | 48 | 0.1030 | 0.0630 | 0.3542 | 4.1 | |
5 | 5fzo:A | 339 | 54 | 0.1152 | 0.0560 | 0.3519 | 5.3 | 5fzo:B, 2ypd:A, 2ypd:B |
6 | 6br7:B | 125 | 93 | 0.1576 | 0.2080 | 0.2796 | 7.9 | 6br7:A, 6vbf:A, 6vbf:B |