TSWELKKQKRLEDKQFKERLKALKDEKEEARQAKITMLKERREKKEENERY
The query sequence (length=51) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6ylg:5 | 78 | 51 | 1.0000 | 0.6538 | 1.0000 | 6.49e-28 | 6ft6:5, 3jct:5, 6m62:5, 7oh3:5, 7ohq:5, 7uoo:5, 7uqb:5, 7uqz:5, 7v08:5, 6ylh:5 |
2 | 8vi8:A | 227 | 48 | 0.2549 | 0.0573 | 0.2708 | 3.4 | 8eyz:A, 8eyz:B, 8eyz:C, 8eyz:D, 8eyz:E, 8eyz:F, 8eyz:G, 8eyz:H, 8eyz:I, 8eyz:J, 8eyz:L, 8eyz:K, 8hnj:A, 8hnj:B, 8hnj:C, 8hnj:D, 8hnj:E, 8hnj:F, 8vi8:B, 8vi8:C, 8vi8:D, 8vi8:E, 8vi8:F, 1wdn:A |
3 | 3vay:A | 230 | 22 | 0.1765 | 0.0391 | 0.4091 | 6.4 | 3vay:B |
4 | 2pyy:B | 217 | 34 | 0.2157 | 0.0507 | 0.3235 | 8.9 | 2pyy:A, 2pyy:C |