TSVEKFLIEKFGSVSDLMQLSEGEESRAFSFDVGGRGYVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLT
YCISRRAQGVTLQDLPETELPAVLQPVAEVMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQTVMDD
TVSASVAQALDELMLWAEDCPEVRHLVHAAFGSNNVLTDNGRITAVIDWSEAMFGDPLYEVANIFFWRPWLACMEQQARY
FERRHPELAGSPRLRAYMLRIGLDQLYQSLVDGNFDDAAWAQGRCDAIVRSGAGT
The query sequence (length=295) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3w0s:A | 298 | 295 | 0.9797 | 0.9698 | 0.9797 | 0.0 | 3tyk:A, 3w0n:A, 3w0o:A, 3w0p:A, 3w0q:A, 3w0r:A |
2 | 3ham:A | 299 | 218 | 0.1525 | 0.1505 | 0.2064 | 0.007 | 4dca:A, 3ham:B, 3hav:A, 3hav:B, 3hav:C, 3uzr:A |
3 | 8i85:A | 280 | 43 | 0.0644 | 0.0679 | 0.4419 | 0.010 | 8i82:A, 8i84:A, 8i86:A, 8i89:A, 8i8g:A, 8i8h:A |
4 | 5igi:A | 300 | 84 | 0.0881 | 0.0867 | 0.3095 | 0.013 | 5igj:A, 5igp:A, 5igr:A, 5igs:A, 5igt:A |
5 | 7f0b:A | 282 | 43 | 0.0576 | 0.0603 | 0.3953 | 0.023 | 7f0c:A, 7f0f:A |
6 | 5uxd:A | 300 | 32 | 0.0475 | 0.0467 | 0.4375 | 0.11 | 5uxc:A, 5uxd:B |
7 | 3dxp:A | 329 | 226 | 0.1661 | 0.1489 | 0.2168 | 0.35 | |
8 | 4e1z:A | 288 | 87 | 0.0780 | 0.0799 | 0.2644 | 0.95 | 4e20:A |
9 | 6a5n:A | 502 | 53 | 0.0610 | 0.0359 | 0.3396 | 0.96 | |
10 | 3f69:B | 283 | 94 | 0.0915 | 0.0954 | 0.2872 | 0.97 | 6b2p:A, 3f61:A, 3f69:A, 2fum:A, 2fum:B, 2fum:C, 2fum:D, 6i2p:A, 6i2p:B, 1mru:A, 1mru:B, 1o6y:A, 3ori:A, 3ori:B, 3ori:C, 3ori:D, 3ork:A, 3orl:A, 3orm:A, 3oro:A, 3orp:A, 3ort:A, 5u94:A |
11 | 1y9g:A | 517 | 64 | 0.0712 | 0.0406 | 0.3281 | 1.4 | |
12 | 7w15:A | 294 | 54 | 0.0610 | 0.0612 | 0.3333 | 1.7 | 7w15:B, 7w19:A, 7w19:B, 7w1a:B, 7w1a:A |
13 | 7ezt:B | 727 | 23 | 0.0441 | 0.0179 | 0.5652 | 3.6 | |
14 | 2rcc:C | 311 | 66 | 0.0678 | 0.0643 | 0.3030 | 3.8 | 2rcc:B |
15 | 2b0q:A | 263 | 166 | 0.1186 | 0.1331 | 0.2108 | 5.6 | 2bkk:A, 2bkk:C, 1j7l:A, 1j7l:B, 1j7u:A, 1j7u:B, 1l8t:A, 3q2j:A, 3q2j:B, 3tm0:A |
16 | 3d45:A | 383 | 69 | 0.0644 | 0.0496 | 0.2754 | 6.1 | 2a1r:A, 2a1r:B |
17 | 3tdw:A | 302 | 207 | 0.1322 | 0.1291 | 0.1884 | 6.3 | 6ctz:A, 3tdv:A, 3tdv:B |
18 | 3d45:B | 373 | 69 | 0.0644 | 0.0509 | 0.2754 | 7.1 | 3ctr:A |
19 | 7s3l:A | 254 | 52 | 0.0475 | 0.0551 | 0.2692 | 7.7 | |
20 | 2vvt:A | 269 | 47 | 0.0441 | 0.0483 | 0.2766 | 7.9 | 2jfo:A, 2jfo:B, 2jfp:A, 2jfp:B, 2vvt:B |
21 | 8bx8:C | 3947 | 76 | 0.0610 | 0.0046 | 0.2368 | 8.1 | 7k58:C, 7k5b:C, 7kek:C |
22 | 4dfb:B | 301 | 34 | 0.0407 | 0.0399 | 0.3529 | 8.1 | 5c4k:A, 5c4l:A, 5c4l:B, 6cd7:B, 4dfb:A, 4dfu:A, 4dfu:B, 4dt8:A, 4dt8:B, 4dt9:A, 4dt9:B, 4dta:A, 4dta:B, 4dtb:A, 4dtb:B, 4n57:A, 4n57:B, 3sg8:A, 3sg8:B, 3sg9:A, 3sg9:B |