BioLiP

>protein
TSSRALPAHLKLKYRQESQGTEEEVRKQDLREALLRAEAAHFATQEHRRWDEDVVFRNTHKGVDDTPRPGFVNDMLRSEF
HKKFLARFVD

The query sequence (length=90) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3jb9:h	90	90	1.0000	1.0000	1.0000	4.13e-63
2	6id0:P	118	89	0.5222	0.3983	0.5281	6.60e-24	8c6j:P, 8ch6:Q, 6ff4:R, 6ff7:R, 8i0s:P, 8i0t:P, 8i0u:P, 8i0v:P, 8i0w:P, 6icz:P, 6id1:P, 5mqf:R, 7qtt:Q, 7w59:P, 7w5a:P, 7w5b:P, 5xjc:P, 5yzg:P, 5z56:P, 5z57:P
3	9fmd:P	106	88	0.4667	0.3962	0.4773	5.83e-18	6qdv:P
4	8ro0:P	150	120	0.4667	0.2800	0.3500	2.01e-17	8ro1:P
5	8ro2:P	112	111	0.4556	0.3661	0.3694	1.95e-16
6	6zym:R	87	89	0.4444	0.4598	0.4494	1.06e-14
7	7b9v:P	74	20	0.1111	0.1351	0.5000	0.028	6bk8:H, 7dco:S, 6exn:P, 5gm6:S, 5gmk:S, 6j6g:S, 6j6h:S, 6j6n:S, 6j6q:S, 5lj3:P, 5lj5:P, 5mps:P, 5mq0:P, 5wsg:S, 5y88:P, 5ylz:P
8	7xkw:A	499	34	0.1556	0.0281	0.4118	0.67
9	3icq:T	949	55	0.1667	0.0158	0.2727	2.6	3icq:U
10	3e18:A	348	13	0.0889	0.0230	0.6154	2.7	3e18:B
11	8e4i:B	769	28	0.1222	0.0143	0.3929	3.3	8e3j:A, 8e3j:B, 8e3p:A, 8e3p:B, 8e4i:A, 8e4k:A, 8e4k:B, 8e4z:A, 8e4z:B, 8e5u:A, 8e5u:B, 8e6g:A, 8e6g:B, 8ecw:A, 8ecw:B, 8egv:A, 8egv:B, 8ehp:A, 8ehp:B, 8eid:A, 8eid:B, 8ekn:A, 8ekn:B, 8ele:A, 8ele:B, 8epj:A, 8epj:B, 8epo:A, 8epo:B, 8epr:A, 8epr:B, 8eq7:A, 8eq7:B, 8eqx:A, 8eqx:B, 8er4:A, 8er4:B, 8etl:A, 8etl:B, 8eto:A, 8eto:B, 8eud:A, 8eud:B, 8eur:A, 8eur:B, 8eut:A, 8eut:B, 8eux:A, 8eux:B, 7r6j:A, 7r6j:B, 7rd2:A, 7rd2:B, 7rev:A, 7rev:B, 7t66:A, 7t66:B, 7t68:A, 7t68:B, 7t8v:A, 7t8v:B
12	2khh:A	57	41	0.1333	0.2105	0.2927	3.9
13	7ane:a	408	22	0.0889	0.0196	0.3636	9.3

[Back]