TSRRFAPFVLAALAILMGAMSVVALCVGAYRIPLAEAWAALSGDPAAQQARAVLLDIRAPRVVLALLVGGGFGATGAAMQ
ALFRNPLADPGLVGVSSGAALGATTLIVLGPASAAALPVAAFAGGLAVAALVYRLAASRGRLALPLLLLAGIAINALVGA
AIGLLTFVADDAQLRSLTFWSLGSLGGAQWPTLAAVAPCVALGGVLLVRERDALNALQLGETEALHLGVPVQRLKRRVLV
AVALAVGALVSCAGIIGFIGLVAPHCVRLACGPDQRIVLPGAALLGALLTLAADLAARTVAAPADIPLGVLTALLGAPFF
LALLWKNRGA
The query sequence (length=330) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5b57:A | 330 | 330 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 5b57:B |
2 | 6g1y:B | 493 | 44 | 0.0515 | 0.0345 | 0.3864 | 0.86 | 6g1y:A, 6g1z:A, 6g1z:B, 6g20:A, 6g20:B |
3 | 5gtb:A | 130 | 31 | 0.0424 | 0.1077 | 0.4516 | 6.4 | |
4 | 8dty:A | 4004 | 118 | 0.1000 | 0.0082 | 0.2797 | 7.7 | 8dty:B, 8dty:C, 8dty:D |
5 | 8dtz:A | 4061 | 118 | 0.1000 | 0.0081 | 0.2797 | 7.8 | 8dtz:B, 8dtz:C, 8dtz:D |