TSLDGLPETQKYVYADEWGFSRVGADFPPGSHPSLFSQLLPQALFAFDARAAVAAVAVPLAAMAAGYGWLWYMHSIAPVW
QQALCAALIGTGYAGLFKVAHECAMMRFIPQMPGLQAALGTLLMAPALYSLPSWRLHHLHHLLHTNMLWQDVWGWHPLTK
VELADEMVRSGGSGGAAMAAARLVLTTPIKLFASVGHWLRSWDGLDLRHFHPASYVEVLSGWAAPLAFAGLVLPAVVSAG
GLSGFVSCYLAPWLVFHFWLSVLSLTAHTAPHIPWRAEGDGWDAGRAAVAGTVTLRLPRPLEVLLNNANYMLPQAVAPGL
PMWSAPAAYAVLAARLGPYLTEASMSLKLLTNHVTRWQIYDEEAHTYRPMEEVVDEIEADLQQLAAAAQQ
The query sequence (length=390) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8xqw:M | 390 | 390 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 8xqx:M |
2 | 6m4k:A | 496 | 90 | 0.0590 | 0.0464 | 0.2556 | 0.50 | 6m4l:A, 6m4m:A |
3 | 8dq6:B | 109 | 35 | 0.0410 | 0.1468 | 0.4571 | 1.1 | 8dq6:A, 8dq6:C |
4 | 3bh4:A | 483 | 63 | 0.0462 | 0.0373 | 0.2857 | 1.2 | 3bh4:B, 1e3x:A, 1e3z:A, 1e40:A, 1e43:A |
5 | 5x9i:A | 333 | 156 | 0.0974 | 0.1141 | 0.2436 | 1.2 | 5x9i:B |
6 | 1bli:A | 481 | 83 | 0.0564 | 0.0457 | 0.2651 | 1.6 | 1ob0:A, 6toy:A, 6toz:A, 6tp0:A, 6tp1:A, 6tp2:A |
7 | 5b2o:A | 1455 | 56 | 0.0385 | 0.0103 | 0.2679 | 2.6 | 5b2p:A, 5b2q:A |
8 | 7n27:A | 57 | 25 | 0.0231 | 0.1579 | 0.3600 | 2.9 | 7n27:D, 7n27:B, 7n27:C, 7n27:E, 7n27:F |
9 | 6ba0:A | 312 | 60 | 0.0462 | 0.0577 | 0.3000 | 3.3 | 6ba0:B, 6ba0:C, 6ba0:D |
10 | 8duj:D | 3865 | 38 | 0.0487 | 0.0049 | 0.5000 | 4.2 | |
11 | 6wou:A | 3921 | 57 | 0.0641 | 0.0064 | 0.4386 | 6.6 | 6wou:B, 6wou:C, 6wou:D, 6wov:A, 6wov:B, 6wov:C, 6wov:D |
12 | 8dty:A | 4004 | 57 | 0.0641 | 0.0062 | 0.4386 | 6.6 | 8dty:B, 8dty:C, 8dty:D |
13 | 8dtz:A | 4061 | 57 | 0.0641 | 0.0062 | 0.4386 | 6.6 | 8dtz:B, 8dtz:C, 8dtz:D |